BLASTP 2.2.4 [Aug-26-2002] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ypuG_nterm_B_subtilis gi|16079379|ref|NP_390203.1| similar to hypothetical proteins [Bacillus subtilis] (78 letters) Database: nr 1,220,597 sequences; 388,937,031 total letters Searching..................................................done Results from round 1 Score E Sequences producing significant alignments: (bits) Value ref|NP_390203.1| (NC_000964) similar to hypothetical proteins [B... 132 1e-30 ref|NP_242426.1| (NC_002570) BH1560~unknown conserved protein [B... 114 4e-25 ref|NP_692749.1| (NC_004193) hypothetical conserved protein [Oce... 107 3e-23 ref|NP_658098.1| (NC_003995) DUF173, Uncharacterized ACR, COG135... 102 1e-21 ref|NP_465475.1| (NC_003210) similar to unknown proteins [Lister... 101 2e-21 ref|NP_471399.1| (NC_003212) similar to unknown proteins [Lister... 101 2e-21 ref|NP_372019.1| (NC_002758) conserved hypothetical protein [Sta... 96 1e-19 gb|ZP_00081131.1| (NZ_AAAS01000008) hypothetical protein [Geobac... 94 3e-19 ref|NP_622944.1| (NC_003869) conserved hypothetical protein [The... 85 3e-16 gb|ZP_00038779.1| (NZ_AAAL01000087) hypothetical protein [Xylell... 84 4e-16 gb|ZP_00041528.1| (NZ_AAAM01000048) hypothetical protein [Xylell... 84 4e-16 ref|NP_299730.1| (NC_002488) conserved hypothetical protein [Xyl... 84 4e-16 gb|ZP_00061108.1| (NZ_AAAJ01000033) hypothetical protein [Clostr... 83 7e-16 gb|ZP_00127918.1| (NZ_AABH01000012) hypothetical protein [Pseudo... 82 1e-15 ref|NP_637568.1| (NC_003902) conserved hypothetical protein [Xan... 82 1e-15 ref|NP_642633.1| (NC_003919) conserved hypothetical protein [Xan... 82 2e-15 gb|ZP_00003382.1| (NZ_AAAY01000001) hypothetical protein [Nitros... 82 2e-15 ref|NP_661042.1| (NC_002932) conserved hypothetical protein [Chl... 82 2e-15 ref|NP_274512.1| (NC_003112) conserved hypothetical protein [Nei... 81 2e-15 ref|NP_284420.1| (NC_003116) hypothetical protein [Neisseria men... 81 3e-15 gb|ZP_00064299.1| (NZ_AAAO01000066) hypothetical protein [Leucon... 80 4e-15 gb|ZP_00046510.1| (NZ_AAAB01000007) hypothetical protein [Lactob... 80 6e-15 ref|NP_267433.1| (NC_002662) HYPOTHETICAL PROTEIN [Lactococcus l... 80 7e-15 ref|NP_722042.1| (NC_004350) conserved hypothetical protein [Str... 80 7e-15 gb|ZP_00083736.1| (NZ_AABA01000085) hypothetical protein [Pseudo... 79 1e-14 ref|NP_251888.1| (NC_002516) conserved hypothetical protein [Pse... 79 2e-14 gb|ZP_00089844.1| (NZ_AAAD01000076) hypothetical protein [Azotob... 78 3e-14 gb|ZP_00022656.1| (NZ_AAAI01000227) hypothetical protein [Ralsto... 78 3e-14 gb|ZP_00029113.1| (NZ_AAAC01000197) hypothetical protein [Burkho... 77 4e-14 ref|NP_688586.1| (NC_004116) conserved hypothetical protein [Str... 77 5e-14 emb|CAD47303.1| (AL766852) unknown [Streptococcus agalactiae] 77 6e-14 ref|NP_520507.1| (NC_003295) CONSERVED HYPOTHETICAL PROTEIN [Ral... 77 7e-14 ref|NP_348680.1| (NC_003030) Uncharacterized ptotrin, YPUG B.sub... 77 7e-14 ref|NP_606660.1| (NC_003485) conserved hypothetical protein [Str... 76 9e-14 ref|NP_359283.1| (NC_003098) Conserved hypothetical protein [Str... 76 1e-13 ref|NP_346308.1| (NC_003028) conserved hypothetical protein [Str... 76 1e-13 gb|ZP_00070137.1| (NZ_AAAZ01000010) hypothetical protein [Oenoco... 76 1e-13 ref|NP_268690.1| (NC_002737) conserved hypothetical protein [Str... 76 1e-13 ref|NP_664071.1| (NC_004070) conserved hypothetical protein [Str... 76 1e-13 emb|CAC19444.1| (AJ277490) hypothetical protein [Streptococcus m... 75 1e-13 gb|ZP_00117780.1| (NZ_AABE01000041) hypothetical protein [Cytoph... 75 2e-13 gb|ZP_00067869.1| (NZ_AAAT01000027) hypothetical protein [Microb... 74 3e-13 ref|NP_718583.1| (NC_004347) conserved hypothetical protein [She... 74 5e-13 ref|NP_540003.1| (NC_003317) Hypothetical Cytosolic Protein [Bru... 72 2e-12 ref|NP_102754.1| (NC_002678) hypothetical protein [Mesorhizobium... 71 2e-12 ref|NP_562721.1| (NC_003366) conserved hypothetical protein [Clo... 71 4e-12 gb|ZP_00012384.1| (NZ_AAAF01000001) hypothetical protein [Rhodop... 70 8e-12 ref|NP_697893.1| (NC_004310) conserved hypothetical protein [Bru... 69 2e-11 gb|ZP_00004407.1| (NZ_AAAE01000050) hypothetical protein [Rhodob... 69 2e-11 ref|NP_385632.1| (NC_003047) CONSERVED HYPOTHETICAL PROTEIN [Sin... 68 3e-11 ref|NP_354696.1| (NC_003062) AGR_C_3139p [Agrobacterium tumefaci... 67 4e-11 ref|NP_219128.1| (NC_000919) conserved hypothetical protein [Tre... 65 2e-10 ref|NP_228303.1| (NC_000853) conserved hypothetical protein [The... 63 9e-10 gb|ZP_00017702.1| (NZ_AAAH01000167) hypothetical protein [Chloro... 62 1e-09 ref|NP_420812.1| (NC_002696) conserved hypothetical protein [Cau... 61 3e-09 ref|NP_600640.2| (NC_003450) hypothetical protein [Corynebacteri... 60 8e-09 gb|ZP_00057587.1| (NZ_AAAQ01000029) hypothetical protein [Thermo... 59 1e-08 ref|NP_325946.1| (NC_002771) conserved hypothetical protein [Myc... 56 1e-07 gb|ZP_00054139.1| (NZ_AAAP01003810) hypothetical protein [Magnet... 56 1e-07 ref|NP_626041.1| (NC_003888) conserved hypothetical protein [Str... 56 1e-07 gb|ZP_00094099.1| (NZ_AAAV01000112) hypothetical protein [Novosp... 55 2e-07 ref|NP_301976.1| (NC_002677) conserved hypothetical protein [Myc... 55 2e-07 ref|NP_216225.1| (NC_000962) hypothetical protein Rv1709 [Mycoba... 55 3e-07 ref|NP_711435.1| (NC_004342) conserved hypothetical protein [Lep... 54 3e-07 ref|NP_603605.1| (NC_003454) Hypothetical cytosolic protein [Fus... 51 3e-06 gb|ZP_00016048.1| (NZ_AAAG01000012) hypothetical protein [Rhodos... 49 1e-05 ref|NP_078179.1| (NC_002162) conserved hypothetical [Ureaplasma ... 49 2e-05 ref|NP_696536.1| (NC_004307) narrowly conserved hypothetical pro... 47 6e-05 gb|ZP_00120635.1| (NZ_AABF01000003) hypothetical protein [Bifido... 45 2e-04 >ref|NP_390203.1| (NC_000964) similar to hypothetical proteins [Bacillus subtilis] sp|P35154|YPUG_BACSU Hypothetical protein ypuG (ORFX7) pir||S45549 conserved hypothetical protein ypuG - Bacillus subtilis gb|AAA67487.1| (L09228) ORFX7 [Bacillus subtilis] emb|CAB14254.1| (Z99116) similar to hypothetical proteins [Bacillus subtilis] Length = 251 Score = 132 bits (331), Expect = 1e-30 Identities = 78/78 (100%), Positives = 78/78 (100%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL Sbjct: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLLSIKSRMLLPKQ Sbjct: 61 VMAATLLSIKSRMLLPKQ 78 >ref|NP_242426.1| (NC_002570) BH1560~unknown conserved protein [Bacillus halodurans] dbj|BAB05279.1| (AP001512) BH1560~unknown conserved protein [Bacillus halodurans] Length = 260 Score = 114 bits (284), Expect = 4e-25 Identities = 61/78 (78%), Positives = 70/78 (89%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 M Y VK+DTFEGPLDLLLHLIN+ E+DIYDIPVA ITEQY+ Y+HTM+ L+LD+ASEYL Sbjct: 1 MNPYSVKLDTFEGPLDLLLHLINQAEVDIYDIPVALITEQYMAYIHTMQELQLDVASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLL IKS+MLLPKQ Sbjct: 61 VMAATLLQIKSKMLLPKQ 78 >ref|NP_692749.1| (NC_004193) hypothetical conserved protein [Oceanobacillus iheyensis] dbj|BAC13784.1| (AP004599) hypothetical conserved protein [Oceanobacillus iheyensis] Length = 249 Score = 107 bits (268), Expect = 3e-23 Identities = 61/77 (79%), Positives = 73/77 (94%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E Y+VK+DTFEGPLDLLLHLIN+ EIDIYDIPVA+IT+QY+ Y+HTM+ LEL+IASEYLV Sbjct: 3 EGYKVKLDTFEGPLDLLLHLINQFEIDIYDIPVAQITQQYMEYIHTMQHLELNIASEYLV 62 Query: 62 MAATLLSIKSRMLLPKQ 78 MA+TLL+IKS+MLLPKQ Sbjct: 63 MASTLLAIKSQMLLPKQ 79 >ref|NP_658098.1| (NC_003995) DUF173, Uncharacterized ACR, COG1354 [Bacillus anthracis A2012] [Bacillus anthracis str. A2012] Length = 247 Score = 102 bits (254), Expect = 1e-21 Identities = 58/75 (77%), Positives = 68/75 (90%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 +Y K++ FEGPLDLLLHLI+R EIDIY+IPVA+ITEQYL YVHTM+ L+LD+ASEYLVM Sbjct: 2 QYNFKVEAFEGPLDLLLHLIHRYEIDIYNIPVAEITEQYLSYVHTMKELQLDVASEYLVM 61 Query: 63 AATLLSIKSRMLLPK 77 AATLL IKS+MLLPK Sbjct: 62 AATLLQIKSKMLLPK 76 >ref|NP_465475.1| (NC_003210) similar to unknown proteins [Listeria monocytogenes EGD-e] emb|CAD00029.1| (AL591981) similar to unknown proteins [Listeria monocytogenes] Length = 249 Score = 101 bits (252), Expect = 2e-21 Identities = 57/78 (73%), Positives = 70/78 (89%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 M E K+D FEGPLDLLLHLI +LE+DIYDIP+A+IT+QY+ +VHTM+ +ELD+ASEYL Sbjct: 1 MVEMNFKVDAFEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHTMQEMELDVASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLL+IKS+MLLPKQ Sbjct: 61 VMAATLLAIKSKMLLPKQ 78 >ref|NP_471399.1| (NC_003212) similar to unknown proteins [Listeria innocua] emb|CAC97295.1| (AL596170) similar to unknown proteins [Listeria innocua] Length = 249 Score = 101 bits (251), Expect = 2e-21 Identities = 56/78 (71%), Positives = 70/78 (88%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 M E K++ FEGPLDLLLHLI +LE+DIYDIP+A+IT+QY+ +VHTM+ +ELD+ASEYL Sbjct: 1 MVEMNFKVEAFEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHTMQEMELDVASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLL+IKS+MLLPKQ Sbjct: 61 VMAATLLAIKSKMLLPKQ 78 >ref|NP_372019.1| (NC_002758) conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374609.1| (NC_002745) conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] ref|NP_646266.1| (NC_003923) conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] dbj|BAB42588.1| (AP003134) conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] dbj|BAB57657.1| (AP003362) conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB95314.1| (AP004827) conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] Length = 251 Score = 95.9 bits (237), Expect = 1e-19 Identities = 50/74 (67%), Positives = 63/74 (84%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 Y+VK+D F GPLDLLLHLI + EIDIYDIP+ +TEQY+ YVH M+ LE++IASEYLV+A Sbjct: 10 YEVKLDAFNGPLDLLLHLIQKFEIDIYDIPMQALTEQYMQYVHAMKQLEINIASEYLVLA 69 Query: 64 ATLLSIKSRMLLPK 77 + LL IKS+MLLP+ Sbjct: 70 SELLMIKSKMLLPQ 83 >gb|ZP_00081131.1| (NZ_AAAS01000008) hypothetical protein [Geobacter metallireducens] Length = 324 Score = 94.4 bits (233), Expect = 3e-19 Identities = 45/73 (61%), Positives = 60/73 (81%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 Y VK++ FEGPLDLLLHLI + E+DIYDIP++ IT++YL Y+ M+ L L+IA E+LVMA Sbjct: 76 YTVKLEVFEGPLDLLLHLIRKNEVDIYDIPLSTITKEYLEYIKMMKELNLEIAGEFLVMA 135 Query: 64 ATLLSIKSRMLLP 76 +TL+ IKS+ LLP Sbjct: 136 STLIQIKSKTLLP 148 >ref|NP_622944.1| (NC_003869) conserved hypothetical protein [Thermoanaerobacter tengcongensis] gb|AAM24548.1| (AE013093) conserved hypothetical protein [Thermoanaerobacter tengcongensis] Length = 247 Score = 84.7 bits (208), Expect = 3e-16 Identities = 43/74 (58%), Positives = 61/74 (82%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 Y VK++ FEGP DLL HLI + EID+ DIP++ I +QY+ Y+ +++ ++LD+ASE++VMA Sbjct: 2 YTVKLEIFEGPFDLLFHLIEKNEIDLMDIPISIILDQYMEYIRSLQEMDLDVASEFIVMA 61 Query: 64 ATLLSIKSRMLLPK 77 ATL+ IKSRMLLPK Sbjct: 62 ATLVEIKSRMLLPK 75 >gb|ZP_00038779.1| (NZ_AAAL01000087) hypothetical protein [Xylella fastidiosa Dixon] Length = 338 Score = 84.0 bits (206), Expect = 4e-16 Identities = 44/73 (60%), Positives = 58/73 (79%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +V +D FEGPLDLLL+LI R ++I DIPVA+IT QY+ Y++ M+ L ++A+EYLVMAA Sbjct: 84 EVILDAFEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYINVMQELRFELAAEYLVMAA 143 Query: 65 TLLSIKSRMLLPK 77 L IKSRMLLP+ Sbjct: 144 ILAEIKSRMLLPR 156 >gb|ZP_00041528.1| (NZ_AAAM01000048) hypothetical protein [Xylella fastidiosa Ann-1] Length = 338 Score = 84.0 bits (206), Expect = 4e-16 Identities = 44/73 (60%), Positives = 58/73 (79%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +V +D FEGPLDLLL+LI R ++I DIPVA+IT QY+ Y++ M+ L ++A+EYLVMAA Sbjct: 84 EVILDAFEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYINVMQELRFELAAEYLVMAA 143 Query: 65 TLLSIKSRMLLPK 77 L IKSRMLLP+ Sbjct: 144 ILAEIKSRMLLPR 156 >ref|NP_299730.1| (NC_002488) conserved hypothetical protein [Xylella fastidiosa 9a5c] pir||G82554 conserved hypothetical protein XF2451 [imported] - Xylella fastidiosa (strain 9a5c) gb|AAF85250.1|AE004054_2 (AE004054) conserved hypothetical protein [Xylella fastidiosa 9a5c] Length = 338 Score = 84.0 bits (206), Expect = 4e-16 Identities = 44/73 (60%), Positives = 58/73 (79%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +V +D FEGPLDLLL+LI R ++I DIPVA+IT QY+ Y++ M+ L ++A+EYLVMAA Sbjct: 84 EVILDAFEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYINVMQELRFELAAEYLVMAA 143 Query: 65 TLLSIKSRMLLPK 77 L IKSRMLLP+ Sbjct: 144 ILAEIKSRMLLPR 156 >gb|ZP_00061108.1| (NZ_AAAJ01000033) hypothetical protein [Clostridium thermocellum ATCC 27405] Length = 261 Score = 83.2 bits (204), Expect = 7e-16 Identities = 44/71 (61%), Positives = 59/71 (82%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +KI FEGP DLL HLI + +I+IYDIP+ +IT+QY+ Y+ M+ L+L+IASE+LVMAAT Sbjct: 8 IKIQNFEGPFDLLFHLIEKNQINIYDIPIHEITDQYMDYLFAMQELDLEIASEFLVMAAT 67 Query: 66 LLSIKSRMLLP 76 LL IKS++LLP Sbjct: 68 LLHIKSKLLLP 78 >gb|ZP_00127918.1| (NZ_AABH01000012) hypothetical protein [Pseudomonas syringae pv. syringae B728a] Length = 272 Score = 82.4 bits (202), Expect = 1e-15 Identities = 45/73 (61%), Positives = 59/73 (80%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +V ++ FEGPLDLLL+LI + IDI DIPVA+IT+QY+ YV M+ + L++A+EYLVMAA Sbjct: 42 EVFLEAFEGPLDLLLYLIRKQNIDILDIPVAEITKQYMGYVELMKTVRLELAAEYLVMAA 101 Query: 65 TLLSIKSRMLLPK 77 L IKSRMLLP+ Sbjct: 102 MLAEIKSRMLLPR 114 >ref|NP_637568.1| (NC_003902) conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gb|AAM41492.1| (AE012329) conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 279 Score = 82.4 bits (202), Expect = 1e-15 Identities = 45/73 (61%), Positives = 58/73 (78%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +V +D FEGPLDLLL+LI R +DI DIPVA+IT QY+ Y++ M+ L ++A+EYLVMAA Sbjct: 26 EVILDAFEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYINVMQELRFELAAEYLVMAA 85 Query: 65 TLLSIKSRMLLPK 77 L IKSRMLLP+ Sbjct: 86 ILAEIKSRMLLPR 98 >ref|NP_642633.1| (NC_003919) conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] gb|AAM37169.1| (AE011869) conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] Length = 279 Score = 82.0 bits (201), Expect = 2e-15 Identities = 45/73 (61%), Positives = 58/73 (78%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +V +D FEGPLDLLL+LI R +DI DIPVA+IT QY+ Y++ M+ L ++A+EYLVMAA Sbjct: 26 EVILDAFEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYINVMQELRFELAAEYLVMAA 85 Query: 65 TLLSIKSRMLLPK 77 L IKSRMLLP+ Sbjct: 86 ILAEIKSRMLLPR 98 >gb|ZP_00003382.1| (NZ_AAAY01000001) hypothetical protein [Nitrosomonas europaea] Length = 254 Score = 81.6 bits (200), Expect = 2e-15 Identities = 43/76 (56%), Positives = 60/76 (78%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E Q+ ++TFEGPLDLLL+LI + +DI DIP+A++T QY+ YV TMR + ++A+EYL+ Sbjct: 18 EALQIFLETFEGPLDLLLYLIRKHNLDILDIPMAELTRQYIAYVETMRADQFELAAEYLL 77 Query: 62 MAATLLSIKSRMLLPK 77 M A L+ IKSRMLLP+ Sbjct: 78 MTALLIDIKSRMLLPR 93 >ref|NP_661042.1| (NC_002932) conserved hypothetical protein [Chlorobium tepidum TLS] gb|AAM71384.1| (AE012792) conserved hypothetical protein [Chlorobium tepidum TLS] Length = 242 Score = 81.6 bits (200), Expect = 2e-15 Identities = 39/74 (52%), Positives = 60/74 (80%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 +++ ++ FEGPLDLLL I R E+DIY+IP++KIT ++ Y+H MR L L++A+E++ MA Sbjct: 2 FRISLEEFEGPLDLLLFFIKRDELDIYNIPISKITGDFIAYIHAMRRLNLEVAAEFIYMA 61 Query: 64 ATLLSIKSRMLLPK 77 + L+SIK+RMLLP+ Sbjct: 62 SMLMSIKARMLLPR 75 >ref|NP_274512.1| (NC_003112) conserved hypothetical protein [Neisseria meningitidis MC58] pir||D81075 conserved hypothetical protein NMB1504 [imported] - Neisseria meningitidis (group B strain MD58) gb|AAF41860.1| (AE002500) conserved hypothetical protein [Neisseria meningitidis MC58] Length = 284 Score = 81.3 bits (199), Expect = 2e-15 Identities = 40/73 (54%), Positives = 57/73 (77%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +V + +F+GPLDLLL+LI + ID+ DIP+ KITEQYL Y+ + + D+A+EYL+MAA Sbjct: 38 KVVLGSFQGPLDLLLYLIRKQNIDVLDIPMVKITEQYLHYIAQIETYQFDLAAEYLLMAA 97 Query: 65 TLLSIKSRMLLPK 77 L+ IKSR+LLP+ Sbjct: 98 MLIEIKSRLLLPR 110 >ref|NP_284420.1| (NC_003116) hypothetical protein [Neisseria meningitidis Z2491] pir||D81866 hypothetical protein NMA1705 [imported] - Neisseria meningitidis (group A strain Z2491) emb|CAB84933.1| (AL162756) hypothetical protein [Neisseria meningitidis Z2491] Length = 284 Score = 80.9 bits (198), Expect = 3e-15 Identities = 40/73 (54%), Positives = 57/73 (77%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +V + +F+GPLDLLL+LI + ID+ DIP+ KITEQYL Y+ + + D+A+EYL+MAA Sbjct: 38 KVVLSSFQGPLDLLLYLIRKQNIDVLDIPMVKITEQYLHYIAQIETYQFDLAAEYLLMAA 97 Query: 65 TLLSIKSRMLLPK 77 L+ IKSR+LLP+ Sbjct: 98 MLIEIKSRLLLPR 110 >gb|ZP_00064299.1| (NZ_AAAO01000066) hypothetical protein [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] Length = 258 Score = 80.5 bits (197), Expect = 4e-15 Identities = 41/73 (56%), Positives = 59/73 (80%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGP+DLLLHLI + E++I+D+ +A IT QYL ++H + ++LD+ASEYLVMAAT Sbjct: 13 IKLSDFEGPIDLLLHLIKKSEMNIFDLKIADITSQYLDFIHAQQAMQLDVASEYLVMAAT 72 Query: 66 LLSIKSRMLLPKQ 78 L+ IKS LLP++ Sbjct: 73 LVKIKSADLLPEE 85 >gb|ZP_00046510.1| (NZ_AAAB01000007) hypothetical protein [Lactobacillus gasseri] Length = 247 Score = 80.1 bits (196), Expect = 6e-15 Identities = 45/76 (59%), Positives = 55/76 (72%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 +E + + F GPLDLLLHLI +IDIYDIP+AKIT QYL + + L+L IA EY V Sbjct: 5 DELTLDLPNFTGPLDLLLHLIRSQKIDIYDIPIAKITGQYLANLARWQTLDLQIAGEYFV 64 Query: 62 MAATLLSIKSRMLLPK 77 MA+TLL IKS+ LLPK Sbjct: 65 MASTLLRIKSQYLLPK 80 >ref|NP_267433.1| (NC_002662) HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis] gb|AAK05375.1|AE006360_4 (AE006360) HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis] Length = 242 Score = 79.7 bits (195), Expect = 7e-15 Identities = 41/76 (53%), Positives = 62/76 (80%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 ++E +KI FEGPLDLLLHL+++ E+DI+++P+ + EQYL+Y+ TM+ LEL++A EY+ Sbjct: 2 IKEINIKIKNFEGPLDLLLHLVSQYEMDIFEVPLVPVIEQYLIYIQTMKELELEVAGEYM 61 Query: 61 VMAATLLSIKSRMLLP 76 +MA+ L+ IKSR LLP Sbjct: 62 LMASQLMLIKSRRLLP 77 >ref|NP_722042.1| (NC_004350) conserved hypothetical protein [Streptococcus mutans UA159] gb|AAN59348.1|AE015000_6 (AE015000) conserved hypothetical protein [Streptococcus mutans UA159] Length = 235 Score = 79.7 bits (195), Expect = 7e-15 Identities = 41/72 (56%), Positives = 59/72 (81%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ E+DIYD+P+ I EQYL Y+ T++ ++L++A EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYEVDIYDVPIVDIIEQYLAYIATLQAMKLEVAGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >gb|ZP_00083736.1| (NZ_AABA01000085) hypothetical protein [Pseudomonas fluorescens] Length = 272 Score = 79.3 bits (194), Expect = 1e-14 Identities = 44/73 (60%), Positives = 58/73 (79%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +V ++ FEGPLDLLL+LI + I+I DIPVA+IT QY+ YV M+ + L++A+EYLVMAA Sbjct: 42 EVFLEAFEGPLDLLLYLIRKQNINILDIPVAEITRQYMGYVELMQSVRLELAAEYLVMAA 101 Query: 65 TLLSIKSRMLLPK 77 L IKSRMLLP+ Sbjct: 102 MLAEIKSRMLLPR 114 >ref|NP_251888.1| (NC_002516) conserved hypothetical protein [Pseudomonas aeruginosa PA01] pir||A83244 conserved hypothetical protein PA3198 [imported] - Pseudomonas aeruginosa (strain PAO1) gb|AAG06586.1|AE004744_1 (AE004744) conserved hypothetical protein [Pseudomonas aeruginosa PA01] Length = 250 Score = 78.6 bits (192), Expect = 2e-14 Identities = 45/73 (61%), Positives = 58/73 (78%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +V ++ FEGPLDLLL+LI + IDI DIPVA+IT QY+ YV M+ + L++A+EYLVMAA Sbjct: 2 EVFLEAFEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYVELMKAVRLELAAEYLVMAA 61 Query: 65 TLLSIKSRMLLPK 77 L IKSRMLLP+ Sbjct: 62 MLAEIKSRMLLPR 74 >gb|ZP_00089844.1| (NZ_AAAD01000076) hypothetical protein [Azotobacter vinelandii] Length = 268 Score = 77.8 bits (190), Expect = 3e-14 Identities = 44/73 (60%), Positives = 56/73 (76%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +V ++ FEGPLDLLL+LI + IDI DIPVA+IT QY+ YV M+ L++A+EYLVMAA Sbjct: 31 EVFLEAFEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYVELMKAARLELAAEYLVMAA 90 Query: 65 TLLSIKSRMLLPK 77 L IKS MLLP+ Sbjct: 91 MLAEIKSHMLLPR 103 >gb|ZP_00022656.1| (NZ_AAAI01000227) hypothetical protein [Ralstonia metallidurans] Length = 343 Score = 77.8 bits (190), Expect = 3e-14 Identities = 39/72 (54%), Positives = 56/72 (77%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +V ++ FEGPLDLLL+LI + ++ DIP+A++T QYL Y+ +R L++A+EYL+MAA Sbjct: 107 EVFLEAFEGPLDLLLYLIRKQNFNVLDIPMAQVTRQYLSYIEQIRKRNLELAAEYLLMAA 166 Query: 65 TLLSIKSRMLLP 76 L+ IKSRMLLP Sbjct: 167 MLIEIKSRMLLP 178 >gb|ZP_00029113.1| (NZ_AAAC01000197) hypothetical protein [Burkholderia fungorum] Length = 291 Score = 77.4 bits (189), Expect = 4e-14 Identities = 42/72 (58%), Positives = 56/72 (77%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +V ++TFEGPLDLLL+LI + ++ DIP+A +T QYL YV +R L++ASEYL+MAA Sbjct: 59 EVFLETFEGPLDLLLYLIRKQNFNVLDIPMADVTVQYLGYVDQLRQTNLELASEYLLMAA 118 Query: 65 TLLSIKSRMLLP 76 L+ IKSRMLLP Sbjct: 119 MLIEIKSRMLLP 130 >ref|NP_688586.1| (NC_004116) conserved hypothetical protein [Streptococcus agalactiae 2603V/R] gb|AAN00459.1|AE014264_14 (AE014264) conserved hypothetical protein [Streptococcus agalactiae 2603V/R] Length = 235 Score = 77.0 bits (188), Expect = 5e-14 Identities = 39/72 (54%), Positives = 59/72 (81%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ E+DIYD+P+ ++ EQYL Y+ T++ + L++A EY++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYEVDIYDVPIVEVIEQYLAYIATLQAMRLEVAGEYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRNLLPK 74 >emb|CAD47303.1| (AL766852) unknown [Streptococcus agalactiae] Length = 235 Score = 77.0 bits (188), Expect = 6e-14 Identities = 39/72 (54%), Positives = 59/72 (81%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ E+DIYD+P+ ++ EQYL Y+ T++ + L++A EY++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYEVDIYDVPIVEVIEQYLAYIATLQAMRLEVAGEYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRNLLPK 74 >ref|NP_520507.1| (NC_003295) CONSERVED HYPOTHETICAL PROTEIN [Ralstonia solanacearum] emb|CAD16093.1| (AL646069) CONSERVED HYPOTHETICAL PROTEIN [Ralstonia solanacearum] Length = 293 Score = 76.6 bits (187), Expect = 7e-14 Identities = 39/72 (54%), Positives = 56/72 (77%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 ++ ++ FEGPLDLLL+LI R ++ DIP+A++T QYL Y+ +R L++A+EYL+MAA Sbjct: 57 EIFLEAFEGPLDLLLYLIRRQNFNVLDIPMAQVTRQYLAYIEQIRATNLELAAEYLLMAA 116 Query: 65 TLLSIKSRMLLP 76 L+ IKSRMLLP Sbjct: 117 MLIEIKSRMLLP 128 >ref|NP_348680.1| (NC_003030) Uncharacterized ptotrin, YPUG B.subtilis ortholog [Clostridium acetobutylicum] gb|AAK80020.1|AE007709_4 (AE007709) Uncharacterized ptotrin, YPUG B.subtilis ortholog [Clostridium acetobutylicum] Length = 249 Score = 76.6 bits (187), Expect = 7e-14 Identities = 40/72 (55%), Positives = 57/72 (78%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 + ID F+GP DLLLHLI + ++DIYDI + IT QY+ Y++ M+ ++L+I SE++VMAAT Sbjct: 5 INIDNFQGPFDLLLHLIRKNKMDIYDIKIFDITNQYIQYLNEMKEMDLEITSEFIVMAAT 64 Query: 66 LLSIKSRMLLPK 77 L+ IKS+ LLPK Sbjct: 65 LIEIKSKYLLPK 76 >ref|NP_606660.1| (NC_003485) conserved hypothetical protein [Streptococcus pyogenes MGAS8232] gb|AAL97159.1| (AE009983) conserved hypothetical protein [Streptococcus pyogenes MGAS8232] Length = 234 Score = 76.3 bits (186), Expect = 9e-14 Identities = 37/72 (51%), Positives = 61/72 (84%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIY++P+ ++ EQYL Y+ T++V++L++A +Y++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETLQVMKLEVAGDYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRRLLPK 74 >ref|NP_359283.1| (NC_003098) Conserved hypothetical protein [Streptococcus pneumoniae R6] emb|CAC19449.1| (AJ277766) hypothetical protein [Streptococcus pneumoniae] gb|AAL00494.1| (AE008534) Conserved hypothetical protein [Streptococcus pneumoniae R6] Length = 242 Score = 75.9 bits (185), Expect = 1e-13 Identities = 39/72 (54%), Positives = 58/72 (80%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIYD+P+ ++ EQYL YV T++ + L++ EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVSTLQAMRLEVTGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >ref|NP_346308.1| (NC_003028) conserved hypothetical protein [Streptococcus pneumoniae TIGR4] gb|AAK75948.1| (AE007478) conserved hypothetical protein [Streptococcus pneumoniae TIGR4] Length = 242 Score = 75.9 bits (185), Expect = 1e-13 Identities = 39/72 (54%), Positives = 58/72 (80%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIYD+P+ ++ EQYL YV T++ + L++ EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVSTLQAMRLEVTGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >gb|ZP_00070137.1| (NZ_AAAZ01000010) hypothetical protein [Oenococcus oeni MCW] Length = 247 Score = 75.9 bits (185), Expect = 1e-13 Identities = 39/75 (52%), Positives = 54/75 (72%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 ++ + +D F GPLDLLLHLI E+DI+D+P+AK+T+Q+L ++ LD A EYL Sbjct: 4 KQLTISLDDFSGPLDLLLHLIRTQELDIFDLPIAKVTDQFLSFIDNQLNPSLDSAGEYLY 63 Query: 62 MAATLLSIKSRMLLP 76 MA+TL+ IKSR LLP Sbjct: 64 MASTLIRIKSRFLLP 78 >ref|NP_268690.1| (NC_002737) conserved hypothetical protein [Streptococcus pyogenes] [Streptococcus pyogenes M1 GAS] gb|AAK33411.1| (AE006500) conserved hypothetical protein [Streptococcus pyogenes M1 GAS] Length = 233 Score = 75.9 bits (185), Expect = 1e-13 Identities = 37/72 (51%), Positives = 61/72 (84%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIY++P+ ++ EQYL Y+ T++V++L++A +Y++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETLQVMKLEVAGDYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRRLLPK 74 >ref|NP_664071.1| (NC_004070) conserved hypothetical protein [Streptococcus pyogenes MGAS315] gb|AAM78874.1| (AE014141) conserved hypothetical protein [Streptococcus pyogenes MGAS315] Length = 234 Score = 75.9 bits (185), Expect = 1e-13 Identities = 37/72 (51%), Positives = 61/72 (84%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIY++P+ ++ EQYL Y+ T++V++L++A +Y++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETLQVMKLEVAGDYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRRLLPK 74 >emb|CAC19444.1| (AJ277490) hypothetical protein [Streptococcus mitis] Length = 242 Score = 75.5 bits (184), Expect = 1e-13 Identities = 39/72 (54%), Positives = 58/72 (80%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIYD+P+ ++ EQYL YV T++ + L++ EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYKMDIYDVPITEVIEQYLAYVSTLQAMRLEVTGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >gb|ZP_00117780.1| (NZ_AABE01000041) hypothetical protein [Cytophaga hutchinsonii] Length = 262 Score = 75.1 bits (183), Expect = 2e-13 Identities = 36/74 (48%), Positives = 57/74 (76%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 +++++ F GP DLLL I R E+DIYDIP++KIT +L Y+H + + +DIASE++++A Sbjct: 7 FEIQLPLFAGPFDLLLFFIERDELDIYDIPISKITNDFLEYIHRLEKMNVDIASEFILVA 66 Query: 64 ATLLSIKSRMLLPK 77 ATL+ IK++ LLP+ Sbjct: 67 ATLMRIKAKTLLPR 80 >gb|ZP_00067869.1| (NZ_AAAT01000027) hypothetical protein [Microbulbifer degradans 2-40] Length = 301 Score = 74.3 bits (181), Expect = 3e-13 Identities = 40/73 (54%), Positives = 54/73 (73%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +V +++F GPLDLLL+LI + IDI +I V+ IT QY+ YV M + ++A+EYLVMAA Sbjct: 67 EVILESFAGPLDLLLYLIRKQNIDILEIDVSAITHQYVAYVEMMEAVHFELAAEYLVMAA 126 Query: 65 TLLSIKSRMLLPK 77 L IKSRMLLP+ Sbjct: 127 MLAEIKSRMLLPR 139 >ref|NP_718583.1| (NC_004347) conserved hypothetical protein [Shewanella oneidensis MR-1] gb|AAN56027.1|AE015738_2 (AE015738) Shewanella oneidensis MR-1 complete genome Length = 262 Score = 73.9 bits (180), Expect = 5e-13 Identities = 39/76 (51%), Positives = 60/76 (78%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E +V +++FEGPLDLLL+LI + ++D+ D+P+++IT QYL Y+ + +++AS+YLV Sbjct: 30 EALEVFLESFEGPLDLLLYLIRKQKLDVVDLPISQITAQYLEYIAMLTQARIELASDYLV 89 Query: 62 MAATLLSIKSRMLLPK 77 MAATL IKSR+LLP+ Sbjct: 90 MAATLAEIKSRLLLPR 105 >ref|NP_540003.1| (NC_003317) Hypothetical Cytosolic Protein [Brucella melitensis] gb|AAL52267.1| (AE009548) Hypothetical Cytosolic Protein [Brucella melitensis] Length = 283 Score = 72.0 bits (175), Expect = 2e-12 Identities = 36/73 (49%), Positives = 50/73 (68%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 + + FEGPLDLLLHL +D+ I V + EQYL +V R L L++A++YLVMAA Sbjct: 37 IDVQGFEGPLDLLLHLARNQRVDLARISVLALAEQYLGFVEQARALRLELAADYLVMAAW 96 Query: 66 LLSIKSRMLLPKQ 78 L +KS++L+PKQ Sbjct: 97 LAYLKSKLLIPKQ 109 >ref|NP_102754.1| (NC_002678) hypothetical protein [Mesorhizobium loti] dbj|BAB48540.1| (AP002996) hypothetical protein [Mesorhizobium loti] Length = 285 Score = 71.2 bits (173), Expect = 2e-12 Identities = 37/73 (50%), Positives = 52/73 (70%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 V + FEGPLDLLLHL ++D+ I + + EQYL +V T R L L++A++YLVMAA Sbjct: 39 VDVAGFEGPLDLLLHLARTQKVDLARISILALVEQYLAFVETARALRLELAADYLVMAAW 98 Query: 66 LLSIKSRMLLPKQ 78 L +KS++L+PKQ Sbjct: 99 LAFLKSKLLIPKQ 111 >ref|NP_562721.1| (NC_003366) conserved hypothetical protein [Clostridium perfringens] dbj|BAB81511.1| (AP003191) conserved hypothetical protein [Clostridium perfringens str. 13] Length = 248 Score = 70.9 bits (172), Expect = 4e-12 Identities = 41/77 (53%), Positives = 58/77 (75%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 ME +K+ F+GP DLLLHLI + E+ I +I + +IT+QYL Y+ M+ L+L+I SE++ Sbjct: 1 MEMPIIKLKNFDGPFDLLLHLIKKNEMSITEIKIHEITKQYLEYIALMKELDLEITSEFI 60 Query: 61 VMAATLLSIKSRMLLPK 77 VMAATL+ IKS+ LLPK Sbjct: 61 VMAATLIEIKSKSLLPK 77 >gb|ZP_00012384.1| (NZ_AAAF01000001) hypothetical protein [Rhodopseudomonas palustris] Length = 342 Score = 69.7 bits (169), Expect = 8e-12 Identities = 32/76 (42%), Positives = 54/76 (70%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E + ++ +EGPLDLLL L + ++D++ I + + +QYLL++ R + L++A++YLV Sbjct: 87 EALVIDVEGYEGPLDLLLTLARQQKVDLHKISILALADQYLLFIEEARKIRLELAADYLV 146 Query: 62 MAATLLSIKSRMLLPK 77 MAA L +KSR+LLP+ Sbjct: 147 MAAWLAFLKSRLLLPE 162 >ref|NP_697893.1| (NC_004310) conserved hypothetical protein [Brucella suis 1330] gb|AAN29808.1|AE014391_3 (AE014391) conserved hypothetical protein [Brucella suis 1330] Length = 245 Score = 68.9 bits (167), Expect = 2e-11 Identities = 36/68 (52%), Positives = 48/68 (69%) Query: 11 FEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIK 70 FEGPLDLLLHL +D+ I V + EQYL +V R L L++A++YLVMAA L +K Sbjct: 4 FEGPLDLLLHLARNQRVDLARISVLALAEQYLGFVEQARALRLELAADYLVMAAWLAYLK 63 Query: 71 SRMLLPKQ 78 S++L+PKQ Sbjct: 64 SKLLIPKQ 71 >gb|ZP_00004407.1| (NZ_AAAE01000050) hypothetical protein [Rhodobacter sphaeroides] Length = 264 Score = 68.6 bits (166), Expect = 2e-11 Identities = 36/71 (50%), Positives = 53/71 (73%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 V ++ FEGPLDLLL L ++D+ I V K++EQYLL+V+ + L +++A++YLVMAA Sbjct: 26 VDVEGFEGPLDLLLTLSRTQKVDLRRISVLKLSEQYLLFVNHAKQLRIELAADYLVMAAW 85 Query: 66 LLSIKSRMLLP 76 L +KSR+LLP Sbjct: 86 LAYLKSRLLLP 96 >ref|NP_385632.1| (NC_003047) CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] emb|CAC46105.1| (AL591787) CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] Length = 288 Score = 67.8 bits (164), Expect = 3e-11 Identities = 35/76 (46%), Positives = 51/76 (67%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 +E V I FEGPLDLLLHL +D+ I V + EQY+ +V R + +++A++YLV Sbjct: 33 DELVVDIAGFEGPLDLLLHLARSQRVDLSRISVLALAEQYIAFVERARSIRIELAADYLV 92 Query: 62 MAATLLSIKSRMLLPK 77 MAA L +KSR+L+P+ Sbjct: 93 MAAWLAYLKSRLLIPQ 108 >ref|NP_354696.1| (NC_003062) AGR_C_3139p [Agrobacterium tumefaciens] [Agrobacterium tumefaciens str. C58 (Cereon)] ref|NP_532392.1| (NC_003304) conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] gb|AAK87481.1| (AE008092) AGR_C_3139p [Agrobacterium tumefaciens str. C58 (Cereon)] gb|AAL42708.1| (AE009127) conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 281 Score = 67.4 bits (163), Expect = 4e-11 Identities = 33/73 (45%), Positives = 52/73 (71%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 + + FEGPLDLLLHL ++D+ I V + EQYL +V + R + +++A++YLVMAA Sbjct: 32 IDVAGFEGPLDLLLHLARTQKVDLSRISVLALAEQYLQFVESARRVRIELAADYLVMAAW 91 Query: 66 LLSIKSRMLLPKQ 78 L +KS++L+P+Q Sbjct: 92 LAFLKSKLLIPQQ 104 >ref|NP_219128.1| (NC_000919) conserved hypothetical protein [Treponema pallidum] pir||H71292 conserved hypothetical protein TP0691 - syphilis spirochete gb|AAC65659.1| (AE001243) conserved hypothetical protein [Treponema pallidum] Length = 252 Score = 65.1 bits (157), Expect = 2e-10 Identities = 39/74 (52%), Positives = 49/74 (65%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 + K+ FEGPLDLLL LI + E+ IYDIP+ +IT QYL YV +L +E+ MAA Sbjct: 12 EFKLSQFEGPLDLLLFLIKKNELSIYDIPICEITAQYLQYVDQTVSPDLRGLTEFYAMAA 71 Query: 65 TLLSIKSRMLLPKQ 78 LL IKS MLLP + Sbjct: 72 VLLYIKSCMLLPME 85 >ref|NP_228303.1| (NC_000853) conserved hypothetical protein [Thermotoga maritima] pir||D72370 conserved hypothetical protein - Thermotoga maritima (strain MSB8) gb|AAD35578.1|AE001726_12 (AE001726) conserved hypothetical protein [Thermotoga maritima] Length = 229 Score = 62.8 bits (151), Expect = 9e-10 Identities = 30/71 (42%), Positives = 57/71 (80%) Query: 7 KIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATL 66 K+ FEGPLDLLL+L+ + ++DI +IP++++ ++++ Y+ M+ L++ I S++L MA+TL Sbjct: 6 KLPVFEGPLDLLLYLVRKKKVDIREIPISQLADEFVEYLEHMKKLDMKITSDFLEMASTL 65 Query: 67 LSIKSRMLLPK 77 + +KS+ML+P+ Sbjct: 66 MELKSKMLIPR 76 >gb|ZP_00017702.1| (NZ_AAAH01000167) hypothetical protein [Chloroflexus aurantiacus] Length = 248 Score = 62.4 bits (150), Expect = 1e-09 Identities = 36/74 (48%), Positives = 49/74 (65%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 Y V + F GPLDLLL LI R E+DI I +A + +QYL +V T+ +E +E++ MA Sbjct: 3 YAVTLPEFTGPLDLLLRLIERAELDITTIALASVADQYLAHVRTLEEVEPRELAEFVSMA 62 Query: 64 ATLLSIKSRMLLPK 77 A L+ IKSR LLP+ Sbjct: 63 ARLILIKSRALLPR 76 >ref|NP_420812.1| (NC_002696) conserved hypothetical protein [Caulobacter crescentus CB15] gb|AAK23980.1| (AE005874) conserved hypothetical protein [Caulobacter crescentus CB15] Length = 274 Score = 61.2 bits (147), Expect = 3e-09 Identities = 31/72 (43%), Positives = 48/72 (66%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 + ID +EGPL +LL L ++D+ + + ++ EQYL +V R + +A++YLVMAA Sbjct: 26 IDIDGYEGPLHVLLALARSQKVDLLQLSITRLAEQYLAFVQQARRVRFALAADYLVMAAW 85 Query: 66 LLSIKSRMLLPK 77 L +KSR+LLPK Sbjct: 86 LAYLKSRLLLPK 97 >ref|NP_600640.2| (NC_003450) hypothetical protein [Corynebacterium glutamicum ATCC 13032] dbj|BAB98815.1| (AP005278) Uncharacterized ACR [Corynebacterium glutamicum ATCC 13032] Length = 255 Score = 59.7 bits (143), Expect = 8e-09 Identities = 29/73 (39%), Positives = 53/73 (71%), Gaps = 1/73 (1%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTM-RVLELDIASEYLVMAA 64 +++D FEGP DLLL LI + ++D+ ++ +A++T++++ Y + +LD +E+LV+AA Sbjct: 1 MQLDNFEGPFDLLLQLITKKKLDVTEVALAQVTDEFIAYTRKLGETSDLDETTEFLVVAA 60 Query: 65 TLLSIKSRMLLPK 77 TLL +K+ LLP+ Sbjct: 61 TLLDLKTARLLPR 73 >gb|ZP_00057587.1| (NZ_AAAQ01000029) hypothetical protein [Thermobifida fusca] Length = 274 Score = 59.3 bits (142), Expect = 1e-08 Identities = 29/75 (38%), Positives = 54/75 (71%), Gaps = 1/75 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMR-VLELDIASEYLVM 62 + V +D FEGP DLLL LI++ ++DI ++ ++K+T++++ ++ +LD+ S +L++ Sbjct: 11 FLVHLDNFEGPFDLLLTLISKHKLDITEVALSKVTDEFIAHIKAYEDSWDLDMVSNFLLV 70 Query: 63 AATLLSIKSRMLLPK 77 AATLL +K+ LLP+ Sbjct: 71 AATLLDLKAARLLPR 85 >ref|NP_325946.1| (NC_002771) conserved hypothetical protein [Mycoplasma pulmonis] emb|CAC13288.1| (AL445563) conserved hypothetical protein [Mycoplasma pulmonis] Length = 249 Score = 56.2 bits (134), Expect = 1e-07 Identities = 33/68 (48%), Positives = 47/68 (68%) Query: 8 IDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLL 67 I F GPLDLLL L+ IDI++I + ++ QYL + ++ ++D+AS+YLVMAATLL Sbjct: 14 IKNFSGPLDLLLSLVKDKNIDIFEINLVELATQYLEIIKKLQDDKIDLASDYLVMAATLL 73 Query: 68 SIKSRMLL 75 IK+ M L Sbjct: 74 QIKASMAL 81 >gb|ZP_00054139.1| (NZ_AAAP01003810) hypothetical protein [Magnetospirillum magnetotacticum] Length = 272 Score = 55.8 bits (133), Expect = 1e-07 Identities = 30/71 (42%), Positives = 47/71 (65%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E + +D +EGPLD+LL L ++D+ I + K+ +QYL +V + ++D+A+EYLV Sbjct: 22 ERLLLDLDGWEGPLDVLLQLARDQKVDLAKISILKLADQYLDFVRKVGREQIDLAAEYLV 81 Query: 62 MAATLLSIKSR 72 MAA L +KSR Sbjct: 82 MAAWLAYLKSR 92 >ref|NP_626041.1| (NC_003888) conserved hypothetical protein [Streptomyces coelicolor A3(2)] pir||T36873 hypothetical protein SCI51.10c - Streptomyces coelicolor emb|CAB52834.1| (AL939110) conserved hypothetical protein [Streptomyces coelicolor A3(2)] Length = 264 Score = 55.8 bits (133), Expect = 1e-07 Identities = 28/72 (38%), Positives = 53/72 (72%), Gaps = 1/72 (1%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRV-LELDIASEYLVMAA 64 +++ FEGP DLLL LI++ ++D+ ++ ++K+T++++ ++ M +LD +E+LV+AA Sbjct: 1 MRLANFEGPFDLLLQLISKHKLDVTEVALSKVTDEFMAHIRAMGPDWDLDQTTEFLVVAA 60 Query: 65 TLLSIKSRMLLP 76 TLL +K+ LLP Sbjct: 61 TLLDLKAARLLP 72 >gb|ZP_00094099.1| (NZ_AAAV01000112) hypothetical protein [Novosphingobium aromaticivorans] Length = 265 Score = 55.5 bits (132), Expect = 2e-07 Identities = 26/59 (44%), Positives = 43/59 (72%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 +++D +EGPLDLLL L R ++D+ I + ++ +QYL Y+ L+L++A++YLVMAA Sbjct: 31 LELDGWEGPLDLLLELARRQKVDLRKISILELVDQYLGYIEQAEALKLELAADYLVMAA 89 >ref|NP_301976.1| (NC_002677) conserved hypothetical protein [Mycobacterium leprae] pir||S72957 hypothetical protein - Mycobacterium leprae gb|AAA50910.1| (U00021) unknown [Mycobacterium leprae] emb|CAB08281.1| (Z95117) hypothetical protein MLC1351.05c [Mycobacterium leprae] emb|CAC31749.1| (AL583921) conserved hypothetical protein [Mycobacterium leprae] Length = 268 Score = 55.1 bits (131), Expect = 2e-07 Identities = 28/74 (37%), Positives = 50/74 (66%), Gaps = 1/74 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTM-RVLELDIASEYLVM 62 +QV++ FEGP DLLLHLI +D+ ++ + ++T+ ++ Y+ + L L+ + +LV+ Sbjct: 11 FQVRLTNFEGPFDLLLHLICAHRLDVTEVALHQVTDDFIAYIRRLGPQLGLEETTAFLVI 70 Query: 63 AATLLSIKSRMLLP 76 AATL+ +K+ LLP Sbjct: 71 AATLIDLKAARLLP 84 >ref|NP_216225.1| (NC_000962) hypothetical protein Rv1709 [Mycobacterium tuberculosis H37Rv] ref|NP_336206.1| (NC_002755) conserved hypothetical protein [Mycobacterium tuberculosis CDC1551] pir||D70504 hypothetical protein Rv1709 - Mycobacterium tuberculosis (strain H37RV) emb|CAB10966.1| (Z98268) hypothetical protein Rv1709 [Mycobacterium tuberculosis H37Rv] gb|AAK46020.1| (AE007037) conserved hypothetical protein [Mycobacterium tuberculosis CDC1551] Length = 278 Score = 54.7 bits (130), Expect = 3e-07 Identities = 28/74 (37%), Positives = 50/74 (66%), Gaps = 1/74 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRV-LELDIASEYLVM 62 ++V++ FEGP DLLL LI ++D+ ++ + ++T+ ++ Y + LEL+ + +LV+ Sbjct: 23 FRVRLTNFEGPFDLLLQLIFAHQLDVTEVALHQVTDDFIAYTKAIGARLELEETTAFLVI 82 Query: 63 AATLLSIKSRMLLP 76 AATLL +K+ LLP Sbjct: 83 AATLLDLKAARLLP 96 >ref|NP_711435.1| (NC_004342) conserved hypothetical protein [Leptospira interrogans serovar lai str. 56601] gb|AAN48453.1|AE011307_6 (AE011307) conserved hypothetical protein [Leptospira interrogans serovar lai str. 56601] Length = 261 Score = 54.3 bits (129), Expect = 3e-07 Identities = 26/65 (40%), Positives = 45/65 (69%) Query: 12 EGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKS 71 EGPL +L LI ++DI+D+ +++IT +L ++ L L++++EY +MAA L+ +KS Sbjct: 23 EGPLSVLWSLIESYKVDIFDVSLSRITRDFLSFLRISETLSLELSAEYALMAANLIYLKS 82 Query: 72 RMLLP 76 + LLP Sbjct: 83 KALLP 87 >ref|NP_603605.1| (NC_003454) Hypothetical cytosolic protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gb|AAL94904.1| (AE010581) Hypothetical cytosolic protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] Length = 225 Score = 50.8 bits (120), Expect = 3e-06 Identities = 28/75 (37%), Positives = 52/75 (69%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 MEE VK++ FEGP DLLL+LI + ++ I DI ++++ ++YL + + ++I S+++ Sbjct: 1 MEEVVVKLNNFEGPFDLLLNLIEKNKMKISDINISQLIDEYLEVLRVSKRENIEIKSDFI 60 Query: 61 VMAATLLSIKSRMLL 75 ++A+ L+ IK+ LL Sbjct: 61 IIASELIEIKTLNLL 75 >gb|ZP_00016048.1| (NZ_AAAG01000012) hypothetical protein [Rhodospirillum rubrum] Length = 236 Score = 49.3 bits (116), Expect = 1e-05 Identities = 24/60 (40%), Positives = 40/60 (66%) Query: 17 LLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRMLLP 76 +LL L ++D+ + + ++ EQYL +V R + L++A +YLVMAA L +KSR+L+P Sbjct: 1 MLLTLARSQKVDLTKLSILRLAEQYLAFVARARQIHLELAGDYLVMAAWLAYLKSRLLIP 60 >ref|NP_078179.1| (NC_002162) conserved hypothetical [Ureaplasma urealyticum] pir||F82903 conserved hypothetical UU345 [imported] - Ureaplasma urealyticum gb|AAF30754.1|AE002131_8 (AE002131) conserved hypothetical [Ureaplasma urealyticum] Length = 294 Score = 48.9 bits (115), Expect = 2e-05 Identities = 26/74 (35%), Positives = 51/74 (68%), Gaps = 1/74 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTM-RVLELDIASEYLVM 62 ++ K F GPLD L LI + +DI ++ + ++++QY+ +V+ + + +++DI ++L M Sbjct: 14 FEYKFIDFNGPLDTLCVLIKQKRLDINNLDILELSKQYVNFVNQLIKTIDIDILGDHLAM 73 Query: 63 AATLLSIKSRMLLP 76 A+ LL +K+RML+P Sbjct: 74 ASYLLELKTRMLMP 87 >ref|NP_696536.1| (NC_004307) narrowly conserved hypothetical protein [Bifidobacterium longum NCC2705] gb|AAN25172.1|AE014767_3 (AE014767) narrowly conserved hypothetical protein [Bifidobacterium longum NCC2705] Length = 304 Score = 47.0 bits (110), Expect = 6e-05 Identities = 24/74 (32%), Positives = 47/74 (63%), Gaps = 1/74 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLE-LDIASEYLVM 62 +QV ++ + GP D LL +I ++++ ++ ++ ITE++L YV + + +D AS +L + Sbjct: 40 FQVNLEVYSGPFDALLGMIANNKLELTEVSLSSITEEFLTYVRGLDFTKNMDEASAFLDI 99 Query: 63 AATLLSIKSRMLLP 76 A+ L+ KS +LP Sbjct: 100 ASILVEAKSVAILP 113 >gb|ZP_00120635.1| (NZ_AABF01000003) hypothetical protein [Bifidobacterium longum DJO10A] Length = 304 Score = 45.1 bits (105), Expect = 2e-04 Identities = 23/74 (31%), Positives = 47/74 (63%), Gaps = 1/74 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLE-LDIASEYLVM 62 ++V ++ + GP D LL +I ++++ ++ ++ ITE++L YV + + +D AS +L + Sbjct: 40 FRVNLEVYSGPFDALLGMIANNKLELTEVSLSSITEEFLTYVRGLDFTKNMDEASAFLDI 99 Query: 63 AATLLSIKSRMLLP 76 A+ L+ KS +LP Sbjct: 100 ASILVEAKSVAILP 113 Searching..................................................done Results from round 2 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: gb|ZP_00081131.1| (NZ_AAAS01000008) hypothetical protein [Geobac... 121 2e-27 ref|NP_242426.1| (NC_002570) BH1560~unknown conserved protein [B... 120 4e-27 ref|NP_390203.1| (NC_000964) similar to hypothetical proteins [B... 119 1e-26 gb|ZP_00041528.1| (NZ_AAAM01000048) hypothetical protein [Xylell... 115 1e-25 gb|ZP_00038779.1| (NZ_AAAL01000087) hypothetical protein [Xylell... 115 1e-25 ref|NP_299730.1| (NC_002488) conserved hypothetical protein [Xyl... 115 1e-25 gb|ZP_00127918.1| (NZ_AABH01000012) hypothetical protein [Pseudo... 114 3e-25 ref|NP_692749.1| (NC_004193) hypothetical conserved protein [Oce... 113 7e-25 gb|ZP_00022656.1| (NZ_AAAI01000227) hypothetical protein [Ralsto... 112 8e-25 gb|ZP_00083736.1| (NZ_AABA01000085) hypothetical protein [Pseudo... 111 2e-24 ref|NP_471399.1| (NC_003212) similar to unknown proteins [Lister... 111 2e-24 ref|NP_637568.1| (NC_003902) conserved hypothetical protein [Xan... 111 3e-24 ref|NP_658098.1| (NC_003995) DUF173, Uncharacterized ACR, COG135... 111 3e-24 gb|ZP_00003382.1| (NZ_AAAY01000001) hypothetical protein [Nitros... 111 3e-24 ref|NP_642633.1| (NC_003919) conserved hypothetical protein [Xan... 110 4e-24 ref|NP_465475.1| (NC_003210) similar to unknown proteins [Lister... 110 4e-24 gb|ZP_00067869.1| (NZ_AAAT01000027) hypothetical protein [Microb... 109 8e-24 ref|NP_622944.1| (NC_003869) conserved hypothetical protein [The... 109 8e-24 ref|NP_520507.1| (NC_003295) CONSERVED HYPOTHETICAL PROTEIN [Ral... 109 8e-24 gb|ZP_00012384.1| (NZ_AAAF01000001) hypothetical protein [Rhodop... 109 1e-23 gb|ZP_00089844.1| (NZ_AAAD01000076) hypothetical protein [Azotob... 109 1e-23 gb|ZP_00029113.1| (NZ_AAAC01000197) hypothetical protein [Burkho... 109 1e-23 ref|NP_540003.1| (NC_003317) Hypothetical Cytosolic Protein [Bru... 108 1e-23 ref|NP_372019.1| (NC_002758) conserved hypothetical protein [Sta... 108 1e-23 ref|NP_274512.1| (NC_003112) conserved hypothetical protein [Nei... 108 2e-23 ref|NP_284420.1| (NC_003116) hypothetical protein [Neisseria men... 108 2e-23 gb|ZP_00046510.1| (NZ_AAAB01000007) hypothetical protein [Lactob... 108 2e-23 gb|ZP_00061108.1| (NZ_AAAJ01000033) hypothetical protein [Clostr... 108 2e-23 ref|NP_718583.1| (NC_004347) conserved hypothetical protein [She... 107 3e-23 ref|NP_251888.1| (NC_002516) conserved hypothetical protein [Pse... 107 4e-23 ref|NP_385632.1| (NC_003047) CONSERVED HYPOTHETICAL PROTEIN [Sin... 106 6e-23 ref|NP_102754.1| (NC_002678) hypothetical protein [Mesorhizobium... 106 1e-22 ref|NP_348680.1| (NC_003030) Uncharacterized ptotrin, YPUG B.sub... 105 1e-22 ref|NP_562721.1| (NC_003366) conserved hypothetical protein [Clo... 105 1e-22 ref|NP_354696.1| (NC_003062) AGR_C_3139p [Agrobacterium tumefaci... 104 2e-22 gb|ZP_00004407.1| (NZ_AAAE01000050) hypothetical protein [Rhodob... 104 3e-22 ref|NP_661042.1| (NC_002932) conserved hypothetical protein [Chl... 104 4e-22 ref|NP_722042.1| (NC_004350) conserved hypothetical protein [Str... 102 9e-22 ref|NP_697893.1| (NC_004310) conserved hypothetical protein [Bru... 101 2e-21 ref|NP_688586.1| (NC_004116) conserved hypothetical protein [Str... 101 3e-21 emb|CAD47303.1| (AL766852) unknown [Streptococcus agalactiae] 101 3e-21 ref|NP_606660.1| (NC_003485) conserved hypothetical protein [Str... 99 6e-21 gb|ZP_00064299.1| (NZ_AAAO01000066) hypothetical protein [Leucon... 99 7e-21 gb|ZP_00070137.1| (NZ_AAAZ01000010) hypothetical protein [Oenoco... 100 8e-21 ref|NP_268690.1| (NC_002737) conserved hypothetical protein [Str... 100 9e-21 ref|NP_664071.1| (NC_004070) conserved hypothetical protein [Str... 100 9e-21 emb|CAC19444.1| (AJ277490) hypothetical protein [Streptococcus m... 99 1e-20 ref|NP_346308.1| (NC_003028) conserved hypothetical protein [Str... 99 1e-20 ref|NP_359283.1| (NC_003098) Conserved hypothetical protein [Str... 99 1e-20 ref|NP_267433.1| (NC_002662) HYPOTHETICAL PROTEIN [Lactococcus l... 98 2e-20 gb|ZP_00117780.1| (NZ_AABE01000041) hypothetical protein [Cytoph... 98 2e-20 gb|ZP_00057587.1| (NZ_AAAQ01000029) hypothetical protein [Thermo... 97 5e-20 ref|NP_420812.1| (NC_002696) conserved hypothetical protein [Cau... 97 8e-20 ref|NP_219128.1| (NC_000919) conserved hypothetical protein [Tre... 96 8e-20 ref|NP_228303.1| (NC_000853) conserved hypothetical protein [The... 95 1e-19 ref|NP_301976.1| (NC_002677) conserved hypothetical protein [Myc... 95 2e-19 ref|NP_600640.2| (NC_003450) hypothetical protein [Corynebacteri... 93 6e-19 gb|ZP_00054139.1| (NZ_AAAP01003810) hypothetical protein [Magnet... 92 1e-18 ref|NP_626041.1| (NC_003888) conserved hypothetical protein [Str... 92 2e-18 gb|ZP_00017702.1| (NZ_AAAH01000167) hypothetical protein [Chloro... 90 9e-18 ref|NP_216225.1| (NC_000962) hypothetical protein Rv1709 [Mycoba... 89 1e-17 gb|ZP_00094099.1| (NZ_AAAV01000112) hypothetical protein [Novosp... 86 7e-17 ref|NP_603605.1| (NC_003454) Hypothetical cytosolic protein [Fus... 86 1e-16 gb|ZP_00016048.1| (NZ_AAAG01000012) hypothetical protein [Rhodos... 84 4e-16 ref|NP_325946.1| (NC_002771) conserved hypothetical protein [Myc... 81 4e-15 ref|NP_711435.1| (NC_004342) conserved hypothetical protein [Lep... 80 5e-15 ref|NP_696536.1| (NC_004307) narrowly conserved hypothetical pro... 79 1e-14 ref|NP_078179.1| (NC_002162) conserved hypothetical [Ureaplasma ... 79 1e-14 gb|ZP_00120635.1| (NZ_AABF01000003) hypothetical protein [Bifido... 78 2e-14 Sequences not found previously or not previously below threshold: ref|NP_126049.1| (NC_000868) hypothetical protein [Pyrococcus ab... 49 1e-05 ref|NP_143634.1| (NC_000961) hypothetical protein [Pyrococcus ho... 48 2e-05 ref|NP_109988.1| (NC_000912) bidomainal:Dihydrofolate Reductase ... 48 3e-05 ref|NP_619196.1| (NC_003552) conserved hypothetical protein [Met... 47 5e-05 gb|ZP_00078476.1| (NZ_AAAR01001933) hypothetical protein [Methan... 47 7e-05 ref|NP_633054.1| (NC_003901) conserved protein [Methanosarcina m... 46 1e-04 >gb|ZP_00081131.1| (NZ_AAAS01000008) hypothetical protein [Geobacter metallireducens] Length = 324 Score = 121 bits (305), Expect = 2e-27 Identities = 45/73 (61%), Positives = 60/73 (81%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 Y VK++ FEGPLDLLLHLI + E+DIYDIP++ IT++YL Y+ M+ L L+IA E+LVMA Sbjct: 76 YTVKLEVFEGPLDLLLHLIRKNEVDIYDIPLSTITKEYLEYIKMMKELNLEIAGEFLVMA 135 Query: 64 ATLLSIKSRMLLP 76 +TL+ IKS+ LLP Sbjct: 136 STLIQIKSKTLLP 148 >ref|NP_242426.1| (NC_002570) BH1560~unknown conserved protein [Bacillus halodurans] dbj|BAB05279.1| (AP001512) BH1560~unknown conserved protein [Bacillus halodurans] Length = 260 Score = 120 bits (302), Expect = 4e-27 Identities = 61/78 (78%), Positives = 70/78 (89%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 M Y VK+DTFEGPLDLLLHLIN+ E+DIYDIPVA ITEQY+ Y+HTM+ L+LD+ASEYL Sbjct: 1 MNPYSVKLDTFEGPLDLLLHLINQAEVDIYDIPVALITEQYMAYIHTMQELQLDVASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLL IKS+MLLPKQ Sbjct: 61 VMAATLLQIKSKMLLPKQ 78 >ref|NP_390203.1| (NC_000964) similar to hypothetical proteins [Bacillus subtilis] sp|P35154|YPUG_BACSU Hypothetical protein ypuG (ORFX7) pir||S45549 conserved hypothetical protein ypuG - Bacillus subtilis gb|AAA67487.1| (L09228) ORFX7 [Bacillus subtilis] emb|CAB14254.1| (Z99116) similar to hypothetical proteins [Bacillus subtilis] Length = 251 Score = 119 bits (299), Expect = 1e-26 Identities = 78/78 (100%), Positives = 78/78 (100%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL Sbjct: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLLSIKSRMLLPKQ Sbjct: 61 VMAATLLSIKSRMLLPKQ 78 >gb|ZP_00041528.1| (NZ_AAAM01000048) hypothetical protein [Xylella fastidiosa Ann-1] Length = 338 Score = 115 bits (290), Expect = 1e-25 Identities = 44/76 (57%), Positives = 59/76 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R ++I DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 81 DALEVILDAFEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYINVMQELRFELAAEYLV 140 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 141 MAAILAEIKSRMLLPR 156 >gb|ZP_00038779.1| (NZ_AAAL01000087) hypothetical protein [Xylella fastidiosa Dixon] Length = 338 Score = 115 bits (290), Expect = 1e-25 Identities = 44/76 (57%), Positives = 59/76 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R ++I DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 81 DALEVILDAFEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYINVMQELRFELAAEYLV 140 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 141 MAAILAEIKSRMLLPR 156 >ref|NP_299730.1| (NC_002488) conserved hypothetical protein [Xylella fastidiosa 9a5c] pir||G82554 conserved hypothetical protein XF2451 [imported] - Xylella fastidiosa (strain 9a5c) gb|AAF85250.1|AE004054_2 (AE004054) conserved hypothetical protein [Xylella fastidiosa 9a5c] Length = 338 Score = 115 bits (289), Expect = 1e-25 Identities = 44/76 (57%), Positives = 59/76 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R ++I DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 81 DALEVILDAFEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYINVMQELRFELAAEYLV 140 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 141 MAAILAEIKSRMLLPR 156 >gb|ZP_00127918.1| (NZ_AABH01000012) hypothetical protein [Pseudomonas syringae pv. syringae B728a] Length = 272 Score = 114 bits (287), Expect = 3e-25 Identities = 45/76 (59%), Positives = 60/76 (78%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++ FEGPLDLLL+LI + IDI DIPVA+IT+QY+ YV M+ + L++A+EYLV Sbjct: 39 DALEVFLEAFEGPLDLLLYLIRKQNIDILDIPVAEITKQYMGYVELMKTVRLELAAEYLV 98 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 99 MAAMLAEIKSRMLLPR 114 >ref|NP_692749.1| (NC_004193) hypothetical conserved protein [Oceanobacillus iheyensis] dbj|BAC13784.1| (AP004599) hypothetical conserved protein [Oceanobacillus iheyensis] Length = 249 Score = 113 bits (283), Expect = 7e-25 Identities = 61/77 (79%), Positives = 73/77 (94%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E Y+VK+DTFEGPLDLLLHLIN+ EIDIYDIPVA+IT+QY+ Y+HTM+ LEL+IASEYLV Sbjct: 3 EGYKVKLDTFEGPLDLLLHLINQFEIDIYDIPVAQITQQYMEYIHTMQHLELNIASEYLV 62 Query: 62 MAATLLSIKSRMLLPKQ 78 MA+TLL+IKS+MLLPKQ Sbjct: 63 MASTLLAIKSQMLLPKQ 79 >gb|ZP_00022656.1| (NZ_AAAI01000227) hypothetical protein [Ralstonia metallidurans] Length = 343 Score = 112 bits (282), Expect = 8e-25 Identities = 39/75 (52%), Positives = 57/75 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++ FEGPLDLLL+LI + ++ DIP+A++T QYL Y+ +R L++A+EYL+ Sbjct: 104 DALEVFLEAFEGPLDLLLYLIRKQNFNVLDIPMAQVTRQYLSYIEQIRKRNLELAAEYLL 163 Query: 62 MAATLLSIKSRMLLP 76 MAA L+ IKSRMLLP Sbjct: 164 MAAMLIEIKSRMLLP 178 >gb|ZP_00083736.1| (NZ_AABA01000085) hypothetical protein [Pseudomonas fluorescens] Length = 272 Score = 111 bits (280), Expect = 2e-24 Identities = 44/76 (57%), Positives = 59/76 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++ FEGPLDLLL+LI + I+I DIPVA+IT QY+ YV M+ + L++A+EYLV Sbjct: 39 DALEVFLEAFEGPLDLLLYLIRKQNINILDIPVAEITRQYMGYVELMQSVRLELAAEYLV 98 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 99 MAAMLAEIKSRMLLPR 114 >ref|NP_471399.1| (NC_003212) similar to unknown proteins [Listeria innocua] emb|CAC97295.1| (AL596170) similar to unknown proteins [Listeria innocua] Length = 249 Score = 111 bits (279), Expect = 2e-24 Identities = 56/78 (71%), Positives = 70/78 (88%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 M E K++ FEGPLDLLLHLI +LE+DIYDIP+A+IT+QY+ +VHTM+ +ELD+ASEYL Sbjct: 1 MVEMNFKVEAFEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHTMQEMELDVASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLL+IKS+MLLPKQ Sbjct: 61 VMAATLLAIKSKMLLPKQ 78 >ref|NP_637568.1| (NC_003902) conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gb|AAM41492.1| (AE012329) conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 279 Score = 111 bits (278), Expect = 3e-24 Identities = 45/76 (59%), Positives = 59/76 (77%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R +DI DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 23 DALEVILDAFEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYINVMQELRFELAAEYLV 82 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 83 MAAILAEIKSRMLLPR 98 >ref|NP_658098.1| (NC_003995) DUF173, Uncharacterized ACR, COG1354 [Bacillus anthracis A2012] [Bacillus anthracis str. A2012] Length = 247 Score = 111 bits (278), Expect = 3e-24 Identities = 58/75 (77%), Positives = 68/75 (90%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 +Y K++ FEGPLDLLLHLI+R EIDIY+IPVA+ITEQYL YVHTM+ L+LD+ASEYLVM Sbjct: 2 QYNFKVEAFEGPLDLLLHLIHRYEIDIYNIPVAEITEQYLSYVHTMKELQLDVASEYLVM 61 Query: 63 AATLLSIKSRMLLPK 77 AATLL IKS+MLLPK Sbjct: 62 AATLLQIKSKMLLPK 76 >gb|ZP_00003382.1| (NZ_AAAY01000001) hypothetical protein [Nitrosomonas europaea] Length = 254 Score = 111 bits (278), Expect = 3e-24 Identities = 43/76 (56%), Positives = 60/76 (78%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E Q+ ++TFEGPLDLLL+LI + +DI DIP+A++T QY+ YV TMR + ++A+EYL+ Sbjct: 18 EALQIFLETFEGPLDLLLYLIRKHNLDILDIPMAELTRQYIAYVETMRADQFELAAEYLL 77 Query: 62 MAATLLSIKSRMLLPK 77 M A L+ IKSRMLLP+ Sbjct: 78 MTALLIDIKSRMLLPR 93 >ref|NP_642633.1| (NC_003919) conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] gb|AAM37169.1| (AE011869) conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] Length = 279 Score = 110 bits (277), Expect = 4e-24 Identities = 45/76 (59%), Positives = 59/76 (77%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R +DI DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 23 DALEVILDAFEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYINVMQELRFELAAEYLV 82 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 83 MAAILAEIKSRMLLPR 98 >ref|NP_465475.1| (NC_003210) similar to unknown proteins [Listeria monocytogenes EGD-e] emb|CAD00029.1| (AL591981) similar to unknown proteins [Listeria monocytogenes] Length = 249 Score = 110 bits (276), Expect = 4e-24 Identities = 57/78 (73%), Positives = 70/78 (89%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 M E K+D FEGPLDLLLHLI +LE+DIYDIP+A+IT+QY+ +VHTM+ +ELD+ASEYL Sbjct: 1 MVEMNFKVDAFEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHTMQEMELDVASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLL+IKS+MLLPKQ Sbjct: 61 VMAATLLAIKSKMLLPKQ 78 >gb|ZP_00067869.1| (NZ_AAAT01000027) hypothetical protein [Microbulbifer degradans 2-40] Length = 301 Score = 109 bits (274), Expect = 8e-24 Identities = 40/76 (52%), Positives = 55/76 (71%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +++F GPLDLLL+LI + IDI +I V+ IT QY+ YV M + ++A+EYLV Sbjct: 64 DALEVILESFAGPLDLLLYLIRKQNIDILEIDVSAITHQYVAYVEMMEAVHFELAAEYLV 123 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 124 MAAMLAEIKSRMLLPR 139 >ref|NP_622944.1| (NC_003869) conserved hypothetical protein [Thermoanaerobacter tengcongensis] gb|AAM24548.1| (AE013093) conserved hypothetical protein [Thermoanaerobacter tengcongensis] Length = 247 Score = 109 bits (274), Expect = 8e-24 Identities = 43/75 (57%), Positives = 61/75 (81%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 Y VK++ FEGP DLL HLI + EID+ DIP++ I +QY+ Y+ +++ ++LD+ASE++VM Sbjct: 1 MYTVKLEIFEGPFDLLFHLIEKNEIDLMDIPISIILDQYMEYIRSLQEMDLDVASEFIVM 60 Query: 63 AATLLSIKSRMLLPK 77 AATL+ IKSRMLLPK Sbjct: 61 AATLVEIKSRMLLPK 75 >ref|NP_520507.1| (NC_003295) CONSERVED HYPOTHETICAL PROTEIN [Ralstonia solanacearum] emb|CAD16093.1| (AL646069) CONSERVED HYPOTHETICAL PROTEIN [Ralstonia solanacearum] Length = 293 Score = 109 bits (274), Expect = 8e-24 Identities = 39/75 (52%), Positives = 57/75 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + ++ ++ FEGPLDLLL+LI R ++ DIP+A++T QYL Y+ +R L++A+EYL+ Sbjct: 54 DALEIFLEAFEGPLDLLLYLIRRQNFNVLDIPMAQVTRQYLAYIEQIRATNLELAAEYLL 113 Query: 62 MAATLLSIKSRMLLP 76 MAA L+ IKSRMLLP Sbjct: 114 MAAMLIEIKSRMLLP 128 >gb|ZP_00012384.1| (NZ_AAAF01000001) hypothetical protein [Rhodopseudomonas palustris] Length = 342 Score = 109 bits (273), Expect = 1e-23 Identities = 32/76 (42%), Positives = 54/76 (70%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E + ++ +EGPLDLLL L + ++D++ I + + +QYLL++ R + L++A++YLV Sbjct: 87 EALVIDVEGYEGPLDLLLTLARQQKVDLHKISILALADQYLLFIEEARKIRLELAADYLV 146 Query: 62 MAATLLSIKSRMLLPK 77 MAA L +KSR+LLP+ Sbjct: 147 MAAWLAFLKSRLLLPE 162 >gb|ZP_00089844.1| (NZ_AAAD01000076) hypothetical protein [Azotobacter vinelandii] Length = 268 Score = 109 bits (273), Expect = 1e-23 Identities = 44/76 (57%), Positives = 57/76 (74%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++ FEGPLDLLL+LI + IDI DIPVA+IT QY+ YV M+ L++A+EYLV Sbjct: 28 DALEVFLEAFEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYVELMKAARLELAAEYLV 87 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKS MLLP+ Sbjct: 88 MAAMLAEIKSHMLLPR 103 >gb|ZP_00029113.1| (NZ_AAAC01000197) hypothetical protein [Burkholderia fungorum] Length = 291 Score = 109 bits (273), Expect = 1e-23 Identities = 42/75 (56%), Positives = 57/75 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++TFEGPLDLLL+LI + ++ DIP+A +T QYL YV +R L++ASEYL+ Sbjct: 56 DALEVFLETFEGPLDLLLYLIRKQNFNVLDIPMADVTVQYLGYVDQLRQTNLELASEYLL 115 Query: 62 MAATLLSIKSRMLLP 76 MAA L+ IKSRMLLP Sbjct: 116 MAAMLIEIKSRMLLP 130 >ref|NP_540003.1| (NC_003317) Hypothetical Cytosolic Protein [Brucella melitensis] gb|AAL52267.1| (AE009548) Hypothetical Cytosolic Protein [Brucella melitensis] Length = 283 Score = 108 bits (272), Expect = 1e-23 Identities = 36/75 (48%), Positives = 50/75 (66%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + + FEGPLDLLLHL +D+ I V + EQYL +V R L L++A++YLVMA Sbjct: 35 LLIDVQGFEGPLDLLLHLARNQRVDLARISVLALAEQYLGFVEQARALRLELAADYLVMA 94 Query: 64 ATLLSIKSRMLLPKQ 78 A L +KS++L+PKQ Sbjct: 95 AWLAYLKSKLLIPKQ 109 >ref|NP_372019.1| (NC_002758) conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374609.1| (NC_002745) conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] ref|NP_646266.1| (NC_003923) conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] dbj|BAB42588.1| (AP003134) conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] dbj|BAB57657.1| (AP003362) conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB95314.1| (AP004827) conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] Length = 251 Score = 108 bits (272), Expect = 1e-23 Identities = 50/75 (66%), Positives = 63/75 (83%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 Y+VK+D F GPLDLLLHLI + EIDIYDIP+ +TEQY+ YVH M+ LE++IASEYLV+ Sbjct: 9 MYEVKLDAFNGPLDLLLHLIQKFEIDIYDIPMQALTEQYMQYVHAMKQLEINIASEYLVL 68 Query: 63 AATLLSIKSRMLLPK 77 A+ LL IKS+MLLP+ Sbjct: 69 ASELLMIKSKMLLPQ 83 >ref|NP_274512.1| (NC_003112) conserved hypothetical protein [Neisseria meningitidis MC58] pir||D81075 conserved hypothetical protein NMB1504 [imported] - Neisseria meningitidis (group B strain MD58) gb|AAF41860.1| (AE002500) conserved hypothetical protein [Neisseria meningitidis MC58] Length = 284 Score = 108 bits (271), Expect = 2e-23 Identities = 40/76 (52%), Positives = 58/76 (75%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V + +F+GPLDLLL+LI + ID+ DIP+ KITEQYL Y+ + + D+A+EYL+ Sbjct: 35 DALKVVLGSFQGPLDLLLYLIRKQNIDVLDIPMVKITEQYLHYIAQIETYQFDLAAEYLL 94 Query: 62 MAATLLSIKSRMLLPK 77 MAA L+ IKSR+LLP+ Sbjct: 95 MAAMLIEIKSRLLLPR 110 >ref|NP_284420.1| (NC_003116) hypothetical protein [Neisseria meningitidis Z2491] pir||D81866 hypothetical protein NMA1705 [imported] - Neisseria meningitidis (group A strain Z2491) emb|CAB84933.1| (AL162756) hypothetical protein [Neisseria meningitidis Z2491] Length = 284 Score = 108 bits (271), Expect = 2e-23 Identities = 40/76 (52%), Positives = 58/76 (75%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V + +F+GPLDLLL+LI + ID+ DIP+ KITEQYL Y+ + + D+A+EYL+ Sbjct: 35 DALKVVLSSFQGPLDLLLYLIRKQNIDVLDIPMVKITEQYLHYIAQIETYQFDLAAEYLL 94 Query: 62 MAATLLSIKSRMLLPK 77 MAA L+ IKSR+LLP+ Sbjct: 95 MAAMLIEIKSRLLLPR 110 >gb|ZP_00046510.1| (NZ_AAAB01000007) hypothetical protein [Lactobacillus gasseri] Length = 247 Score = 108 bits (270), Expect = 2e-23 Identities = 45/76 (59%), Positives = 55/76 (72%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 +E + + F GPLDLLLHLI +IDIYDIP+AKIT QYL + + L+L IA EY V Sbjct: 5 DELTLDLPNFTGPLDLLLHLIRSQKIDIYDIPIAKITGQYLANLARWQTLDLQIAGEYFV 64 Query: 62 MAATLLSIKSRMLLPK 77 MA+TLL IKS+ LLPK Sbjct: 65 MASTLLRIKSQYLLPK 80 >gb|ZP_00061108.1| (NZ_AAAJ01000033) hypothetical protein [Clostridium thermocellum ATCC 27405] Length = 261 Score = 108 bits (270), Expect = 2e-23 Identities = 44/75 (58%), Positives = 60/75 (79%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +KI FEGP DLL HLI + +I+IYDIP+ +IT+QY+ Y+ M+ L+L+IASE+LV Sbjct: 4 KACTIKIQNFEGPFDLLFHLIEKNQINIYDIPIHEITDQYMDYLFAMQELDLEIASEFLV 63 Query: 62 MAATLLSIKSRMLLP 76 MAATLL IKS++LLP Sbjct: 64 MAATLLHIKSKLLLP 78 >ref|NP_718583.1| (NC_004347) conserved hypothetical protein [Shewanella oneidensis MR-1] gb|AAN56027.1|AE015738_2 (AE015738) Shewanella oneidensis MR-1 complete genome Length = 262 Score = 107 bits (269), Expect = 3e-23 Identities = 39/76 (51%), Positives = 60/76 (78%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E +V +++FEGPLDLLL+LI + ++D+ D+P+++IT QYL Y+ + +++AS+YLV Sbjct: 30 EALEVFLESFEGPLDLLLYLIRKQKLDVVDLPISQITAQYLEYIAMLTQARIELASDYLV 89 Query: 62 MAATLLSIKSRMLLPK 77 MAATL IKSR+LLP+ Sbjct: 90 MAATLAEIKSRLLLPR 105 >ref|NP_251888.1| (NC_002516) conserved hypothetical protein [Pseudomonas aeruginosa PA01] pir||A83244 conserved hypothetical protein PA3198 [imported] - Pseudomonas aeruginosa (strain PAO1) gb|AAG06586.1|AE004744_1 (AE004744) conserved hypothetical protein [Pseudomonas aeruginosa PA01] Length = 250 Score = 107 bits (268), Expect = 4e-23 Identities = 45/74 (60%), Positives = 58/74 (77%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 +V ++ FEGPLDLLL+LI + IDI DIPVA+IT QY+ YV M+ + L++A+EYLVMA Sbjct: 1 MEVFLEAFEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYVELMKAVRLELAAEYLVMA 60 Query: 64 ATLLSIKSRMLLPK 77 A L IKSRMLLP+ Sbjct: 61 AMLAEIKSRMLLPR 74 >ref|NP_385632.1| (NC_003047) CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] emb|CAC46105.1| (AL591787) CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] Length = 288 Score = 106 bits (266), Expect = 6e-23 Identities = 35/76 (46%), Positives = 51/76 (67%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 +E V I FEGPLDLLLHL +D+ I V + EQY+ +V R + +++A++YLV Sbjct: 33 DELVVDIAGFEGPLDLLLHLARSQRVDLSRISVLALAEQYIAFVERARSIRIELAADYLV 92 Query: 62 MAATLLSIKSRMLLPK 77 MAA L +KSR+L+P+ Sbjct: 93 MAAWLAYLKSRLLIPQ 108 >ref|NP_102754.1| (NC_002678) hypothetical protein [Mesorhizobium loti] dbj|BAB48540.1| (AP002996) hypothetical protein [Mesorhizobium loti] Length = 285 Score = 106 bits (265), Expect = 1e-22 Identities = 37/75 (49%), Positives = 52/75 (69%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 V + FEGPLDLLLHL ++D+ I + + EQYL +V T R L L++A++YLVMA Sbjct: 37 LVVDVAGFEGPLDLLLHLARTQKVDLARISILALVEQYLAFVETARALRLELAADYLVMA 96 Query: 64 ATLLSIKSRMLLPKQ 78 A L +KS++L+PKQ Sbjct: 97 AWLAFLKSKLLIPKQ 111 >ref|NP_348680.1| (NC_003030) Uncharacterized ptotrin, YPUG B.subtilis ortholog [Clostridium acetobutylicum] gb|AAK80020.1|AE007709_4 (AE007709) Uncharacterized ptotrin, YPUG B.subtilis ortholog [Clostridium acetobutylicum] Length = 249 Score = 105 bits (264), Expect = 1e-22 Identities = 40/74 (54%), Positives = 57/74 (76%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + ID F+GP DLLLHLI + ++DIYDI + IT QY+ Y++ M+ ++L+I SE++VMA Sbjct: 3 LNINIDNFQGPFDLLLHLIRKNKMDIYDIKIFDITNQYIQYLNEMKEMDLEITSEFIVMA 62 Query: 64 ATLLSIKSRMLLPK 77 ATL+ IKS+ LLPK Sbjct: 63 ATLIEIKSKYLLPK 76 >ref|NP_562721.1| (NC_003366) conserved hypothetical protein [Clostridium perfringens] dbj|BAB81511.1| (AP003191) conserved hypothetical protein [Clostridium perfringens str. 13] Length = 248 Score = 105 bits (264), Expect = 1e-22 Identities = 41/77 (53%), Positives = 58/77 (75%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 ME +K+ F+GP DLLLHLI + E+ I +I + +IT+QYL Y+ M+ L+L+I SE++ Sbjct: 1 MEMPIIKLKNFDGPFDLLLHLIKKNEMSITEIKIHEITKQYLEYIALMKELDLEITSEFI 60 Query: 61 VMAATLLSIKSRMLLPK 77 VMAATL+ IKS+ LLPK Sbjct: 61 VMAATLIEIKSKSLLPK 77 >ref|NP_354696.1| (NC_003062) AGR_C_3139p [Agrobacterium tumefaciens] [Agrobacterium tumefaciens str. C58 (Cereon)] ref|NP_532392.1| (NC_003304) conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] gb|AAK87481.1| (AE008092) AGR_C_3139p [Agrobacterium tumefaciens str. C58 (Cereon)] gb|AAL42708.1| (AE009127) conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 281 Score = 104 bits (261), Expect = 2e-22 Identities = 33/75 (44%), Positives = 52/75 (69%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + + FEGPLDLLLHL ++D+ I V + EQYL +V + R + +++A++YLVMA Sbjct: 30 LVIDVAGFEGPLDLLLHLARTQKVDLSRISVLALAEQYLQFVESARRVRIELAADYLVMA 89 Query: 64 ATLLSIKSRMLLPKQ 78 A L +KS++L+P+Q Sbjct: 90 AWLAFLKSKLLIPQQ 104 >gb|ZP_00004407.1| (NZ_AAAE01000050) hypothetical protein [Rhodobacter sphaeroides] Length = 264 Score = 104 bits (261), Expect = 3e-22 Identities = 37/75 (49%), Positives = 54/75 (71%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E V ++ FEGPLDLLL L ++D+ I V K++EQYLL+V+ + L +++A++YLV Sbjct: 22 EALIVDVEGFEGPLDLLLTLSRTQKVDLRRISVLKLSEQYLLFVNHAKQLRIELAADYLV 81 Query: 62 MAATLLSIKSRMLLP 76 MAA L +KSR+LLP Sbjct: 82 MAAWLAYLKSRLLLP 96 >ref|NP_661042.1| (NC_002932) conserved hypothetical protein [Chlorobium tepidum TLS] gb|AAM71384.1| (AE012792) conserved hypothetical protein [Chlorobium tepidum TLS] Length = 242 Score = 104 bits (260), Expect = 4e-22 Identities = 39/75 (52%), Positives = 60/75 (80%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 +++ ++ FEGPLDLLL I R E+DIY+IP++KIT ++ Y+H MR L L++A+E++ M Sbjct: 1 MFRISLEEFEGPLDLLLFFIKRDELDIYNIPISKITGDFIAYIHAMRRLNLEVAAEFIYM 60 Query: 63 AATLLSIKSRMLLPK 77 A+ L+SIK+RMLLP+ Sbjct: 61 ASMLMSIKARMLLPR 75 >ref|NP_722042.1| (NC_004350) conserved hypothetical protein [Streptococcus mutans UA159] gb|AAN59348.1|AE015000_6 (AE015000) conserved hypothetical protein [Streptococcus mutans UA159] Length = 235 Score = 102 bits (256), Expect = 9e-22 Identities = 41/72 (56%), Positives = 59/72 (81%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ E+DIYD+P+ I EQYL Y+ T++ ++L++A EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYEVDIYDVPIVDIIEQYLAYIATLQAMKLEVAGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >ref|NP_697893.1| (NC_004310) conserved hypothetical protein [Brucella suis 1330] gb|AAN29808.1|AE014391_3 (AE014391) conserved hypothetical protein [Brucella suis 1330] Length = 245 Score = 101 bits (254), Expect = 2e-21 Identities = 36/69 (52%), Positives = 48/69 (69%) Query: 10 TFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSI 69 FEGPLDLLLHL +D+ I V + EQYL +V R L L++A++YLVMAA L + Sbjct: 3 GFEGPLDLLLHLARNQRVDLARISVLALAEQYLGFVEQARALRLELAADYLVMAAWLAYL 62 Query: 70 KSRMLLPKQ 78 KS++L+PKQ Sbjct: 63 KSKLLIPKQ 71 >ref|NP_688586.1| (NC_004116) conserved hypothetical protein [Streptococcus agalactiae 2603V/R] gb|AAN00459.1|AE014264_14 (AE014264) conserved hypothetical protein [Streptococcus agalactiae 2603V/R] Length = 235 Score = 101 bits (252), Expect = 3e-21 Identities = 39/72 (54%), Positives = 59/72 (81%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ E+DIYD+P+ ++ EQYL Y+ T++ + L++A EY++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYEVDIYDVPIVEVIEQYLAYIATLQAMRLEVAGEYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRNLLPK 74 >emb|CAD47303.1| (AL766852) unknown [Streptococcus agalactiae] Length = 235 Score = 101 bits (252), Expect = 3e-21 Identities = 39/72 (54%), Positives = 59/72 (81%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ E+DIYD+P+ ++ EQYL Y+ T++ + L++A EY++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYEVDIYDVPIVEVIEQYLAYIATLQAMRLEVAGEYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRNLLPK 74 >ref|NP_606660.1| (NC_003485) conserved hypothetical protein [Streptococcus pyogenes MGAS8232] gb|AAL97159.1| (AE009983) conserved hypothetical protein [Streptococcus pyogenes MGAS8232] Length = 234 Score = 99 bits (249), Expect = 6e-21 Identities = 37/72 (51%), Positives = 61/72 (84%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIY++P+ ++ EQYL Y+ T++V++L++A +Y++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETLQVMKLEVAGDYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRRLLPK 74 >gb|ZP_00064299.1| (NZ_AAAO01000066) hypothetical protein [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] Length = 258 Score = 99 bits (249), Expect = 7e-21 Identities = 41/77 (53%), Positives = 59/77 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 +K+ FEGP+DLLLHLI + E++I+D+ +A IT QYL ++H + ++LD+ASEYLV Sbjct: 9 NGLTIKLSDFEGPIDLLLHLIKKSEMNIFDLKIADITSQYLDFIHAQQAMQLDVASEYLV 68 Query: 62 MAATLLSIKSRMLLPKQ 78 MAATL+ IKS LLP++ Sbjct: 69 MAATLVKIKSADLLPEE 85 >gb|ZP_00070137.1| (NZ_AAAZ01000010) hypothetical protein [Oenococcus oeni MCW] Length = 247 Score = 99.6 bits (248), Expect = 8e-21 Identities = 39/75 (52%), Positives = 54/75 (72%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 ++ + +D F GPLDLLLHLI E+DI+D+P+AK+T+Q+L ++ LD A EYL Sbjct: 4 KQLTISLDDFSGPLDLLLHLIRTQELDIFDLPIAKVTDQFLSFIDNQLNPSLDSAGEYLY 63 Query: 62 MAATLLSIKSRMLLP 76 MA+TL+ IKSR LLP Sbjct: 64 MASTLIRIKSRFLLP 78 >ref|NP_268690.1| (NC_002737) conserved hypothetical protein [Streptococcus pyogenes] [Streptococcus pyogenes M1 GAS] gb|AAK33411.1| (AE006500) conserved hypothetical protein [Streptococcus pyogenes M1 GAS] Length = 233 Score = 99.6 bits (248), Expect = 9e-21 Identities = 37/72 (51%), Positives = 61/72 (84%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIY++P+ ++ EQYL Y+ T++V++L++A +Y++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETLQVMKLEVAGDYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRRLLPK 74 >ref|NP_664071.1| (NC_004070) conserved hypothetical protein [Streptococcus pyogenes MGAS315] gb|AAM78874.1| (AE014141) conserved hypothetical protein [Streptococcus pyogenes MGAS315] Length = 234 Score = 99.6 bits (248), Expect = 9e-21 Identities = 37/72 (51%), Positives = 61/72 (84%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIY++P+ ++ EQYL Y+ T++V++L++A +Y++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETLQVMKLEVAGDYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRRLLPK 74 >emb|CAC19444.1| (AJ277490) hypothetical protein [Streptococcus mitis] Length = 242 Score = 99.2 bits (247), Expect = 1e-20 Identities = 39/72 (54%), Positives = 58/72 (80%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIYD+P+ ++ EQYL YV T++ + L++ EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYKMDIYDVPITEVIEQYLAYVSTLQAMRLEVTGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >ref|NP_346308.1| (NC_003028) conserved hypothetical protein [Streptococcus pneumoniae TIGR4] gb|AAK75948.1| (AE007478) conserved hypothetical protein [Streptococcus pneumoniae TIGR4] Length = 242 Score = 98.8 bits (246), Expect = 1e-20 Identities = 39/72 (54%), Positives = 58/72 (80%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIYD+P+ ++ EQYL YV T++ + L++ EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVSTLQAMRLEVTGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >ref|NP_359283.1| (NC_003098) Conserved hypothetical protein [Streptococcus pneumoniae R6] emb|CAC19449.1| (AJ277766) hypothetical protein [Streptococcus pneumoniae] gb|AAL00494.1| (AE008534) Conserved hypothetical protein [Streptococcus pneumoniae R6] Length = 242 Score = 98.8 bits (246), Expect = 1e-20 Identities = 39/72 (54%), Positives = 58/72 (80%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIYD+P+ ++ EQYL YV T++ + L++ EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVSTLQAMRLEVTGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >ref|NP_267433.1| (NC_002662) HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis] gb|AAK05375.1|AE006360_4 (AE006360) HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis] Length = 242 Score = 98.4 bits (245), Expect = 2e-20 Identities = 41/76 (53%), Positives = 62/76 (80%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 ++E +KI FEGPLDLLLHL+++ E+DI+++P+ + EQYL+Y+ TM+ LEL++A EY+ Sbjct: 2 IKEINIKIKNFEGPLDLLLHLVSQYEMDIFEVPLVPVIEQYLIYIQTMKELELEVAGEYM 61 Query: 61 VMAATLLSIKSRMLLP 76 +MA+ L+ IKSR LLP Sbjct: 62 LMASQLMLIKSRRLLP 77 >gb|ZP_00117780.1| (NZ_AABE01000041) hypothetical protein [Cytophaga hutchinsonii] Length = 262 Score = 98.1 bits (244), Expect = 2e-20 Identities = 36/74 (48%), Positives = 57/74 (76%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 +++++ F GP DLLL I R E+DIYDIP++KIT +L Y+H + + +DIASE++++A Sbjct: 7 FEIQLPLFAGPFDLLLFFIERDELDIYDIPISKITNDFLEYIHRLEKMNVDIASEFILVA 66 Query: 64 ATLLSIKSRMLLPK 77 ATL+ IK++ LLP+ Sbjct: 67 ATLMRIKAKTLLPR 80 >gb|ZP_00057587.1| (NZ_AAAQ01000029) hypothetical protein [Thermobifida fusca] Length = 274 Score = 96.9 bits (241), Expect = 5e-20 Identities = 29/75 (38%), Positives = 54/75 (71%), Gaps = 1/75 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMR-VLELDIASEYLVM 62 + V +D FEGP DLLL LI++ ++DI ++ ++K+T++++ ++ +LD+ S +L++ Sbjct: 11 FLVHLDNFEGPFDLLLTLISKHKLDITEVALSKVTDEFIAHIKAYEDSWDLDMVSNFLLV 70 Query: 63 AATLLSIKSRMLLPK 77 AATLL +K+ LLP+ Sbjct: 71 AATLLDLKAARLLPR 85 >ref|NP_420812.1| (NC_002696) conserved hypothetical protein [Caulobacter crescentus CB15] gb|AAK23980.1| (AE005874) conserved hypothetical protein [Caulobacter crescentus CB15] Length = 274 Score = 96.5 bits (240), Expect = 8e-20 Identities = 31/75 (41%), Positives = 48/75 (63%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 + ID +EGPL +LL L ++D+ + + ++ EQYL +V R + +A++YLVM Sbjct: 23 ALVIDIDGYEGPLHVLLALARSQKVDLLQLSITRLAEQYLAFVQQARRVRFALAADYLVM 82 Query: 63 AATLLSIKSRMLLPK 77 AA L +KSR+LLPK Sbjct: 83 AAWLAYLKSRLLLPK 97 >ref|NP_219128.1| (NC_000919) conserved hypothetical protein [Treponema pallidum] pir||H71292 conserved hypothetical protein TP0691 - syphilis spirochete gb|AAC65659.1| (AE001243) conserved hypothetical protein [Treponema pallidum] Length = 252 Score = 96.1 bits (239), Expect = 8e-20 Identities = 39/74 (52%), Positives = 49/74 (65%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 + K+ FEGPLDLLL LI + E+ IYDIP+ +IT QYL YV +L +E+ MAA Sbjct: 12 EFKLSQFEGPLDLLLFLIKKNELSIYDIPICEITAQYLQYVDQTVSPDLRGLTEFYAMAA 71 Query: 65 TLLSIKSRMLLPKQ 78 LL IKS MLLP + Sbjct: 72 VLLYIKSCMLLPME 85 >ref|NP_228303.1| (NC_000853) conserved hypothetical protein [Thermotoga maritima] pir||D72370 conserved hypothetical protein - Thermotoga maritima (strain MSB8) gb|AAD35578.1|AE001726_12 (AE001726) conserved hypothetical protein [Thermotoga maritima] Length = 229 Score = 95.4 bits (237), Expect = 1e-19 Identities = 30/74 (40%), Positives = 57/74 (76%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 K+ FEGPLDLLL+L+ + ++DI +IP++++ ++++ Y+ M+ L++ I S++L MA Sbjct: 3 LVFKLPVFEGPLDLLLYLVRKKKVDIREIPISQLADEFVEYLEHMKKLDMKITSDFLEMA 62 Query: 64 ATLLSIKSRMLLPK 77 +TL+ +KS+ML+P+ Sbjct: 63 STLMELKSKMLIPR 76 >ref|NP_301976.1| (NC_002677) conserved hypothetical protein [Mycobacterium leprae] pir||S72957 hypothetical protein - Mycobacterium leprae gb|AAA50910.1| (U00021) unknown [Mycobacterium leprae] emb|CAB08281.1| (Z95117) hypothetical protein MLC1351.05c [Mycobacterium leprae] emb|CAC31749.1| (AL583921) conserved hypothetical protein [Mycobacterium leprae] Length = 268 Score = 95.0 bits (236), Expect = 2e-19 Identities = 28/76 (36%), Positives = 50/76 (64%), Gaps = 1/76 (1%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMR-VLELDIASEYL 60 +QV++ FEGP DLLLHLI +D+ ++ + ++T+ ++ Y+ + L L+ + +L Sbjct: 9 NGFQVRLTNFEGPFDLLLHLICAHRLDVTEVALHQVTDDFIAYIRRLGPQLGLEETTAFL 68 Query: 61 VMAATLLSIKSRMLLP 76 V+AATL+ +K+ LLP Sbjct: 69 VIAATLIDLKAARLLP 84 >ref|NP_600640.2| (NC_003450) hypothetical protein [Corynebacterium glutamicum ATCC 13032] dbj|BAB98815.1| (AP005278) Uncharacterized ACR [Corynebacterium glutamicum ATCC 13032] Length = 255 Score = 93.4 bits (232), Expect = 6e-19 Identities = 29/73 (39%), Positives = 53/73 (71%), Gaps = 1/73 (1%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTM-RVLELDIASEYLVMAA 64 +++D FEGP DLLL LI + ++D+ ++ +A++T++++ Y + +LD +E+LV+AA Sbjct: 1 MQLDNFEGPFDLLLQLITKKKLDVTEVALAQVTDEFIAYTRKLGETSDLDETTEFLVVAA 60 Query: 65 TLLSIKSRMLLPK 77 TLL +K+ LLP+ Sbjct: 61 TLLDLKTARLLPR 73 >gb|ZP_00054139.1| (NZ_AAAP01003810) hypothetical protein [Magnetospirillum magnetotacticum] Length = 272 Score = 92.3 bits (229), Expect = 1e-18 Identities = 30/71 (42%), Positives = 47/71 (65%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E + +D +EGPLD+LL L ++D+ I + K+ +QYL +V + ++D+A+EYLV Sbjct: 22 ERLLLDLDGWEGPLDVLLQLARDQKVDLAKISILKLADQYLDFVRKVGREQIDLAAEYLV 81 Query: 62 MAATLLSIKSR 72 MAA L +KSR Sbjct: 82 MAAWLAYLKSR 92 >ref|NP_626041.1| (NC_003888) conserved hypothetical protein [Streptomyces coelicolor A3(2)] pir||T36873 hypothetical protein SCI51.10c - Streptomyces coelicolor emb|CAB52834.1| (AL939110) conserved hypothetical protein [Streptomyces coelicolor A3(2)] Length = 264 Score = 91.9 bits (228), Expect = 2e-18 Identities = 28/72 (38%), Positives = 53/72 (72%), Gaps = 1/72 (1%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMR-VLELDIASEYLVMAA 64 +++ FEGP DLLL LI++ ++D+ ++ ++K+T++++ ++ M +LD +E+LV+AA Sbjct: 1 MRLANFEGPFDLLLQLISKHKLDVTEVALSKVTDEFMAHIRAMGPDWDLDQTTEFLVVAA 60 Query: 65 TLLSIKSRMLLP 76 TLL +K+ LLP Sbjct: 61 TLLDLKAARLLP 72 >gb|ZP_00017702.1| (NZ_AAAH01000167) hypothetical protein [Chloroflexus aurantiacus] Length = 248 Score = 89.6 bits (222), Expect = 9e-18 Identities = 36/74 (48%), Positives = 49/74 (65%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 Y V + F GPLDLLL LI R E+DI I +A + +QYL +V T+ +E +E++ MA Sbjct: 3 YAVTLPEFTGPLDLLLRLIERAELDITTIALASVADQYLAHVRTLEEVEPRELAEFVSMA 62 Query: 64 ATLLSIKSRMLLPK 77 A L+ IKSR LLP+ Sbjct: 63 ARLILIKSRALLPR 76 >ref|NP_216225.1| (NC_000962) hypothetical protein Rv1709 [Mycobacterium tuberculosis H37Rv] ref|NP_336206.1| (NC_002755) conserved hypothetical protein [Mycobacterium tuberculosis CDC1551] pir||D70504 hypothetical protein Rv1709 - Mycobacterium tuberculosis (strain H37RV) emb|CAB10966.1| (Z98268) hypothetical protein Rv1709 [Mycobacterium tuberculosis H37Rv] gb|AAK46020.1| (AE007037) conserved hypothetical protein [Mycobacterium tuberculosis CDC1551] Length = 278 Score = 89.2 bits (221), Expect = 1e-17 Identities = 28/74 (37%), Positives = 50/74 (66%), Gaps = 1/74 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMR-VLELDIASEYLVM 62 ++V++ FEGP DLLL LI ++D+ ++ + ++T+ ++ Y + LEL+ + +LV+ Sbjct: 23 FRVRLTNFEGPFDLLLQLIFAHQLDVTEVALHQVTDDFIAYTKAIGARLELEETTAFLVI 82 Query: 63 AATLLSIKSRMLLP 76 AATLL +K+ LLP Sbjct: 83 AATLLDLKAARLLP 96 >gb|ZP_00094099.1| (NZ_AAAV01000112) hypothetical protein [Novosphingobium aromaticivorans] Length = 265 Score = 86.5 bits (214), Expect = 7e-17 Identities = 32/75 (42%), Positives = 52/75 (68%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 +++D +EGPLDLLL L R ++D+ I + ++ +QYL Y+ L+L++A++YLVM Sbjct: 28 ALYLELDGWEGPLDLLLELARRQKVDLRKISILELVDQYLGYIEQAEALKLELAADYLVM 87 Query: 63 AATLLSIKSRMLLPK 77 AA L +KS +LLP+ Sbjct: 88 AAWLAYLKSLLLLPR 102 >ref|NP_603605.1| (NC_003454) Hypothetical cytosolic protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gb|AAL94904.1| (AE010581) Hypothetical cytosolic protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] Length = 225 Score = 85.7 bits (212), Expect = 1e-16 Identities = 28/75 (37%), Positives = 52/75 (69%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 MEE VK++ FEGP DLLL+LI + ++ I DI ++++ ++YL + + ++I S+++ Sbjct: 1 MEEVVVKLNNFEGPFDLLLNLIEKNKMKISDINISQLIDEYLEVLRVSKRENIEIKSDFI 60 Query: 61 VMAATLLSIKSRMLL 75 ++A+ L+ IK+ LL Sbjct: 61 IIASELIEIKTLNLL 75 >gb|ZP_00016048.1| (NZ_AAAG01000012) hypothetical protein [Rhodospirillum rubrum] Length = 236 Score = 84.2 bits (208), Expect = 4e-16 Identities = 24/60 (40%), Positives = 40/60 (66%) Query: 17 LLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRMLLP 76 +LL L ++D+ + + ++ EQYL +V R + L++A +YLVMAA L +KSR+L+P Sbjct: 1 MLLTLARSQKVDLTKLSILRLAEQYLAFVARARQIHLELAGDYLVMAAWLAYLKSRLLIP 60 >ref|NP_325946.1| (NC_002771) conserved hypothetical protein [Mycoplasma pulmonis] emb|CAC13288.1| (AL445563) conserved hypothetical protein [Mycoplasma pulmonis] Length = 249 Score = 80.7 bits (199), Expect = 4e-15 Identities = 33/71 (46%), Positives = 47/71 (65%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 I F GPLDLLL L+ IDI++I + ++ QYL + ++ ++D+AS+YLVMAA Sbjct: 11 VFNIKNFSGPLDLLLSLVKDKNIDIFEINLVELATQYLEIIKKLQDDKIDLASDYLVMAA 70 Query: 65 TLLSIKSRMLL 75 TLL IK+ M L Sbjct: 71 TLLQIKASMAL 81 >ref|NP_711435.1| (NC_004342) conserved hypothetical protein [Leptospira interrogans serovar lai str. 56601] gb|AAN48453.1|AE011307_6 (AE011307) conserved hypothetical protein [Leptospira interrogans serovar lai str. 56601] Length = 261 Score = 80.3 bits (198), Expect = 5e-15 Identities = 26/65 (40%), Positives = 45/65 (69%) Query: 12 EGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKS 71 EGPL +L LI ++DI+D+ +++IT +L ++ L L++++EY +MAA L+ +KS Sbjct: 23 EGPLSVLWSLIESYKVDIFDVSLSRITRDFLSFLRISETLSLELSAEYALMAANLIYLKS 82 Query: 72 RMLLP 76 + LLP Sbjct: 83 KALLP 87 >ref|NP_696536.1| (NC_004307) narrowly conserved hypothetical protein [Bifidobacterium longum NCC2705] gb|AAN25172.1|AE014767_3 (AE014767) narrowly conserved hypothetical protein [Bifidobacterium longum NCC2705] Length = 304 Score = 78.8 bits (194), Expect = 1e-14 Identities = 24/74 (32%), Positives = 46/74 (61%), Gaps = 1/74 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVL-ELDIASEYLVM 62 +QV ++ + GP D LL +I ++++ ++ ++ ITE++L YV + +D AS +L + Sbjct: 40 FQVNLEVYSGPFDALLGMIANNKLELTEVSLSSITEEFLTYVRGLDFTKNMDEASAFLDI 99 Query: 63 AATLLSIKSRMLLP 76 A+ L+ KS +LP Sbjct: 100 ASILVEAKSVAILP 113 >ref|NP_078179.1| (NC_002162) conserved hypothetical [Ureaplasma urealyticum] pir||F82903 conserved hypothetical UU345 [imported] - Ureaplasma urealyticum gb|AAF30754.1|AE002131_8 (AE002131) conserved hypothetical [Ureaplasma urealyticum] Length = 294 Score = 78.8 bits (194), Expect = 1e-14 Identities = 26/74 (35%), Positives = 51/74 (68%), Gaps = 1/74 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTM-RVLELDIASEYLVM 62 ++ K F GPLD L LI + +DI ++ + ++++QY+ +V+ + + +++DI ++L M Sbjct: 14 FEYKFIDFNGPLDTLCVLIKQKRLDINNLDILELSKQYVNFVNQLIKTIDIDILGDHLAM 73 Query: 63 AATLLSIKSRMLLP 76 A+ LL +K+RML+P Sbjct: 74 ASYLLELKTRMLMP 87 >gb|ZP_00120635.1| (NZ_AABF01000003) hypothetical protein [Bifidobacterium longum DJO10A] Length = 304 Score = 78.4 bits (193), Expect = 2e-14 Identities = 23/74 (31%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVL-ELDIASEYLVM 62 ++V ++ + GP D LL +I ++++ ++ ++ ITE++L YV + +D AS +L + Sbjct: 40 FRVNLEVYSGPFDALLGMIANNKLELTEVSLSSITEEFLTYVRGLDFTKNMDEASAFLDI 99 Query: 63 AATLLSIKSRMLLP 76 A+ L+ KS +LP Sbjct: 100 ASILVEAKSVAILP 113 >ref|NP_126049.1| (NC_000868) hypothetical protein [Pyrococcus abyssi] pir||A75150 hypothetical protein PAB2110 - Pyrococcus abyssi (strain Orsay) emb|CAB49280.1| (AJ248284) Hypothetical protein [Pyrococcus abyssi] Length = 218 Score = 49.1 bits (117), Expect = 1e-05 Identities = 22/75 (29%), Positives = 47/75 (62%), Gaps = 4/75 (5%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 ME ++ ++ P+D+LL L+ ++D ++I + +TE+Y+ + M+ L+L I++ + Sbjct: 1 MERFEPEVT----PVDILLQLVKMGKVDPWNIDIVDLTEKYIKMLREMQELDLRISARAI 56 Query: 61 VMAATLLSIKSRMLL 75 + A+ L+ +KS LL Sbjct: 57 LAASILVRMKSEALL 71 >ref|NP_143634.1| (NC_000961) hypothetical protein [Pyrococcus horikoshii] pir||E71190 hypothetical protein PH1797 - Pyrococcus horikoshii Length = 213 Score = 48.4 bits (115), Expect = 2e-05 Identities = 20/62 (32%), Positives = 41/62 (65%) Query: 14 PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRM 73 P+D+LL L+ ++D ++I + +TE+Y+ + M+ L+L I++ ++ A+ L+ +KS Sbjct: 8 PVDILLQLVKMGKVDPWNIDIVDLTEKYIKMLREMQELDLRISARAILAASILVRMKSEA 67 Query: 74 LL 75 LL Sbjct: 68 LL 69 >ref|NP_109988.1| (NC_000912) bidomainal:Dihydrofolate Reductase and C-terminal domain is conserved hypo-thetical [Mycoplasma pneumoniae] sp|P75478|Y213_MYCPN Hypothetical protein MG213 homolog (H10_orf506) pir||S73862 dihyrofolate reductase homolog H10_orf506 - Mycoplasma pneumoniae (strain ATCC 29342) gb|AAB96184.1| (AE000052) bidomainal:Dihydrofolate Reductase and C-terminal domain is conserved hypo-thetical [Mycoplasma pneumoniae] Length = 506 Score = 48.0 bits (114), Expect = 3e-05 Identities = 20/73 (27%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHT-MRVLELDIASEYLVM 62 + V ++ + G L LL L+ + +++ + +AKIT QYL ++T + ++ ++YLV+ Sbjct: 161 FNVFLEDYNGTLPNLLELLIDKKFNLHQVDIAKITTQYLHLINTNLNKQAIEPITDYLVI 220 Query: 63 AATLLSIKSRMLL 75 + ++ K+ LL Sbjct: 221 TSRIVEQKANNLL 233 >ref|NP_619196.1| (NC_003552) conserved hypothetical protein [Methanosarcina acetivorans str. C2A] [Methanosarcina acetivorans C2A] gb|AAM07676.1| (AE011151) conserved hypothetical protein [Methanosarcina acetivorans str. C2A] [Methanosarcina acetivorans C2A] Length = 361 Score = 47.2 bits (112), Expect = 5e-05 Identities = 23/72 (31%), Positives = 43/72 (58%), Gaps = 2/72 (2%) Query: 6 VKIDTFEG--PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + + F PL +L+ L +ID +DI V ++T+ +L V ++ ++L I+S L+ + Sbjct: 53 LDLSEFNTYEPLGILVELAKDGKIDPWDIDVVQLTDSFLQRVEELQKMDLRISSRTLLYS 112 Query: 64 ATLLSIKSRMLL 75 A LL +KS ++L Sbjct: 113 AILLRMKSSVIL 124 >gb|ZP_00078476.1| (NZ_AAAR01001933) hypothetical protein [Methanosarcina barkeri] Length = 339 Score = 46.8 bits (111), Expect = 7e-05 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Query: 6 VKIDTFEG--PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + I FE PL +L+ L +ID +DI + ++T+ +L V ++ ++L I+S L+ + Sbjct: 54 LDISEFETSEPLGILVELARVGKIDPWDIDIVQLTDGFLRKVEELKQMDLRISSRTLLYS 113 Query: 64 ATLLSIKSRMLL 75 A LL +KS +L Sbjct: 114 AILLRMKSSGIL 125 >ref|NP_633054.1| (NC_003901) conserved protein [Methanosarcina mazei Goe1] gb|AAM30726.1| (AE013329) conserved protein [Methanosarcina mazei Goe1] Length = 334 Score = 45.7 bits (108), Expect = 1e-04 Identities = 21/72 (29%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Query: 6 VKIDTFEG--PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + + F PL +L+ L +ID +DI V ++T+ +L + ++ ++L I+S L+ + Sbjct: 52 LDLSEFNTCEPLGILVELAKDGKIDPWDIDVVQLTDNFLRRIEELQKMDLRISSRTLLYS 111 Query: 64 ATLLSIKSRMLL 75 A LL +KS +++ Sbjct: 112 AILLRMKSSVIM 123 Searching..................................................done Results from round 3 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: gb|ZP_00081131.1| (NZ_AAAS01000008) hypothetical protein [Geobac... 118 2e-26 ref|NP_242426.1| (NC_002570) BH1560~unknown conserved protein [B... 117 3e-26 ref|NP_390203.1| (NC_000964) similar to hypothetical proteins [B... 115 2e-25 gb|ZP_00041528.1| (NZ_AAAM01000048) hypothetical protein [Xylell... 114 2e-25 gb|ZP_00038779.1| (NZ_AAAL01000087) hypothetical protein [Xylell... 114 2e-25 ref|NP_299730.1| (NC_002488) conserved hypothetical protein [Xyl... 114 3e-25 gb|ZP_00127918.1| (NZ_AABH01000012) hypothetical protein [Pseudo... 113 4e-25 gb|ZP_00022656.1| (NZ_AAAI01000227) hypothetical protein [Ralsto... 113 8e-25 gb|ZP_00083736.1| (NZ_AABA01000085) hypothetical protein [Pseudo... 111 2e-24 ref|NP_692749.1| (NC_004193) hypothetical conserved protein [Oce... 110 3e-24 ref|NP_637568.1| (NC_003902) conserved hypothetical protein [Xan... 109 6e-24 gb|ZP_00012384.1| (NZ_AAAF01000001) hypothetical protein [Rhodop... 109 6e-24 ref|NP_642633.1| (NC_003919) conserved hypothetical protein [Xan... 109 7e-24 ref|NP_471399.1| (NC_003212) similar to unknown proteins [Lister... 109 9e-24 gb|ZP_00029113.1| (NZ_AAAC01000197) hypothetical protein [Burkho... 109 1e-23 ref|NP_520507.1| (NC_003295) CONSERVED HYPOTHETICAL PROTEIN [Ral... 108 1e-23 ref|NP_658098.1| (NC_003995) DUF173, Uncharacterized ACR, COG135... 108 1e-23 gb|ZP_00089844.1| (NZ_AAAD01000076) hypothetical protein [Azotob... 108 2e-23 gb|ZP_00067869.1| (NZ_AAAT01000027) hypothetical protein [Microb... 108 2e-23 gb|ZP_00003382.1| (NZ_AAAY01000001) hypothetical protein [Nitros... 108 2e-23 ref|NP_284420.1| (NC_003116) hypothetical protein [Neisseria men... 108 2e-23 ref|NP_465475.1| (NC_003210) similar to unknown proteins [Lister... 108 2e-23 ref|NP_622944.1| (NC_003869) conserved hypothetical protein [The... 107 3e-23 ref|NP_274512.1| (NC_003112) conserved hypothetical protein [Nei... 107 3e-23 gb|ZP_00046510.1| (NZ_AAAB01000007) hypothetical protein [Lactob... 106 5e-23 gb|ZP_00061108.1| (NZ_AAAJ01000033) hypothetical protein [Clostr... 106 6e-23 ref|NP_372019.1| (NC_002758) conserved hypothetical protein [Sta... 106 6e-23 ref|NP_718583.1| (NC_004347) conserved hypothetical protein [She... 106 7e-23 ref|NP_540003.1| (NC_003317) Hypothetical Cytosolic Protein [Bru... 105 1e-22 ref|NP_348680.1| (NC_003030) Uncharacterized ptotrin, YPUG B.sub... 104 2e-22 ref|NP_251888.1| (NC_002516) conserved hypothetical protein [Pse... 104 2e-22 ref|NP_385632.1| (NC_003047) CONSERVED HYPOTHETICAL PROTEIN [Sin... 103 5e-22 ref|NP_102754.1| (NC_002678) hypothetical protein [Mesorhizobium... 103 5e-22 gb|ZP_00004407.1| (NZ_AAAE01000050) hypothetical protein [Rhodob... 103 8e-22 ref|NP_354696.1| (NC_003062) AGR_C_3139p [Agrobacterium tumefaci... 103 8e-22 ref|NP_562721.1| (NC_003366) conserved hypothetical protein [Clo... 102 9e-22 ref|NP_661042.1| (NC_002932) conserved hypothetical protein [Chl... 102 1e-21 ref|NP_722042.1| (NC_004350) conserved hypothetical protein [Str... 100 5e-21 gb|ZP_00064299.1| (NZ_AAAO01000066) hypothetical protein [Leucon... 100 5e-21 ref|NP_688586.1| (NC_004116) conserved hypothetical protein [Str... 100 8e-21 emb|CAD47303.1| (AL766852) unknown [Streptococcus agalactiae] 100 9e-21 ref|NP_697893.1| (NC_004310) conserved hypothetical protein [Bru... 99 2e-20 ref|NP_606660.1| (NC_003485) conserved hypothetical protein [Str... 98 2e-20 ref|NP_664071.1| (NC_004070) conserved hypothetical protein [Str... 98 4e-20 ref|NP_268690.1| (NC_002737) conserved hypothetical protein [Str... 97 4e-20 emb|CAC19444.1| (AJ277490) hypothetical protein [Streptococcus m... 97 5e-20 gb|ZP_00117780.1| (NZ_AABE01000041) hypothetical protein [Cytoph... 97 8e-20 gb|ZP_00070137.1| (NZ_AAAZ01000010) hypothetical protein [Oenoco... 96 8e-20 ref|NP_346308.1| (NC_003028) conserved hypothetical protein [Str... 96 9e-20 ref|NP_359283.1| (NC_003098) Conserved hypothetical protein [Str... 96 1e-19 ref|NP_219128.1| (NC_000919) conserved hypothetical protein [Tre... 95 1e-19 ref|NP_267433.1| (NC_002662) HYPOTHETICAL PROTEIN [Lactococcus l... 95 2e-19 ref|NP_420812.1| (NC_002696) conserved hypothetical protein [Cau... 95 2e-19 ref|NP_228303.1| (NC_000853) conserved hypothetical protein [The... 94 3e-19 gb|ZP_00057587.1| (NZ_AAAQ01000029) hypothetical protein [Thermo... 93 6e-19 ref|NP_301976.1| (NC_002677) conserved hypothetical protein [Myc... 93 8e-19 gb|ZP_00054139.1| (NZ_AAAP01003810) hypothetical protein [Magnet... 91 2e-18 ref|NP_600640.2| (NC_003450) hypothetical protein [Corynebacteri... 91 3e-18 ref|NP_626041.1| (NC_003888) conserved hypothetical protein [Str... 89 1e-17 gb|ZP_00017702.1| (NZ_AAAH01000167) hypothetical protein [Chloro... 87 4e-17 ref|NP_216225.1| (NC_000962) hypothetical protein Rv1709 [Mycoba... 86 6e-17 gb|ZP_00094099.1| (NZ_AAAV01000112) hypothetical protein [Novosp... 86 7e-17 ref|NP_603605.1| (NC_003454) Hypothetical cytosolic protein [Fus... 83 6e-16 ref|NP_325946.1| (NC_002771) conserved hypothetical protein [Myc... 81 3e-15 gb|ZP_00016048.1| (NZ_AAAG01000012) hypothetical protein [Rhodos... 81 3e-15 ref|NP_696536.1| (NC_004307) narrowly conserved hypothetical pro... 79 1e-14 gb|ZP_00120635.1| (NZ_AABF01000003) hypothetical protein [Bifido... 78 2e-14 ref|NP_711435.1| (NC_004342) conserved hypothetical protein [Lep... 78 3e-14 ref|NP_078179.1| (NC_002162) conserved hypothetical [Ureaplasma ... 77 5e-14 ref|NP_619196.1| (NC_003552) conserved hypothetical protein [Met... 74 5e-13 gb|ZP_00078476.1| (NZ_AAAR01001933) hypothetical protein [Methan... 73 8e-13 ref|NP_633054.1| (NC_003901) conserved protein [Methanosarcina m... 72 1e-12 ref|NP_109988.1| (NC_000912) bidomainal:Dihydrofolate Reductase ... 72 2e-12 ref|NP_126049.1| (NC_000868) hypothetical protein [Pyrococcus ab... 71 3e-12 ref|NP_143634.1| (NC_000961) hypothetical protein [Pyrococcus ho... 68 4e-11 Sequences not found previously or not previously below threshold: ref|NP_579571.1| (NC_003413) hypothetical protein [Pyrococcus fu... 58 3e-08 ref|NP_279432.1| (NC_002607) Vng0340c [Halobacterium sp. NRC-1] ... 55 2e-07 ref|NP_070388.1| (NC_000917) conserved hypothetical protein [Arc... 52 2e-06 ref|NP_248126.1| (NC_000909) conserved hypothetical protein [Met... 51 3e-06 ref|NP_213299.1| (NC_000918) hypothetical protein [Aquifex aeoli... 51 5e-06 ref|NP_682448.1| (NC_004113) ORF_ID:tll1658~hypothetical protein... 47 7e-05 >gb|ZP_00081131.1| (NZ_AAAS01000008) hypothetical protein [Geobacter metallireducens] Length = 324 Score = 118 bits (296), Expect = 2e-26 Identities = 45/73 (61%), Positives = 60/73 (81%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 Y VK++ FEGPLDLLLHLI + E+DIYDIP++ IT++YL Y+ M+ L L+IA E+LVMA Sbjct: 76 YTVKLEVFEGPLDLLLHLIRKNEVDIYDIPLSTITKEYLEYIKMMKELNLEIAGEFLVMA 135 Query: 64 ATLLSIKSRMLLP 76 +TL+ IKS+ LLP Sbjct: 136 STLIQIKSKTLLP 148 >ref|NP_242426.1| (NC_002570) BH1560~unknown conserved protein [Bacillus halodurans] dbj|BAB05279.1| (AP001512) BH1560~unknown conserved protein [Bacillus halodurans] Length = 260 Score = 117 bits (294), Expect = 3e-26 Identities = 61/78 (78%), Positives = 70/78 (89%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 M Y VK+DTFEGPLDLLLHLIN+ E+DIYDIPVA ITEQY+ Y+HTM+ L+LD+ASEYL Sbjct: 1 MNPYSVKLDTFEGPLDLLLHLINQAEVDIYDIPVALITEQYMAYIHTMQELQLDVASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLL IKS+MLLPKQ Sbjct: 61 VMAATLLQIKSKMLLPKQ 78 >ref|NP_390203.1| (NC_000964) similar to hypothetical proteins [Bacillus subtilis] sp|P35154|YPUG_BACSU Hypothetical protein ypuG (ORFX7) pir||S45549 conserved hypothetical protein ypuG - Bacillus subtilis gb|AAA67487.1| (L09228) ORFX7 [Bacillus subtilis] emb|CAB14254.1| (Z99116) similar to hypothetical proteins [Bacillus subtilis] Length = 251 Score = 115 bits (289), Expect = 2e-25 Identities = 78/78 (100%), Positives = 78/78 (100%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL Sbjct: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLLSIKSRMLLPKQ Sbjct: 61 VMAATLLSIKSRMLLPKQ 78 >gb|ZP_00041528.1| (NZ_AAAM01000048) hypothetical protein [Xylella fastidiosa Ann-1] Length = 338 Score = 114 bits (287), Expect = 2e-25 Identities = 44/76 (57%), Positives = 59/76 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R ++I DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 81 DALEVILDAFEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYINVMQELRFELAAEYLV 140 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 141 MAAILAEIKSRMLLPR 156 >gb|ZP_00038779.1| (NZ_AAAL01000087) hypothetical protein [Xylella fastidiosa Dixon] Length = 338 Score = 114 bits (287), Expect = 2e-25 Identities = 44/76 (57%), Positives = 59/76 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R ++I DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 81 DALEVILDAFEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYINVMQELRFELAAEYLV 140 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 141 MAAILAEIKSRMLLPR 156 >ref|NP_299730.1| (NC_002488) conserved hypothetical protein [Xylella fastidiosa 9a5c] pir||G82554 conserved hypothetical protein XF2451 [imported] - Xylella fastidiosa (strain 9a5c) gb|AAF85250.1|AE004054_2 (AE004054) conserved hypothetical protein [Xylella fastidiosa 9a5c] Length = 338 Score = 114 bits (286), Expect = 3e-25 Identities = 44/76 (57%), Positives = 59/76 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R ++I DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 81 DALEVILDAFEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYINVMQELRFELAAEYLV 140 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 141 MAAILAEIKSRMLLPR 156 >gb|ZP_00127918.1| (NZ_AABH01000012) hypothetical protein [Pseudomonas syringae pv. syringae B728a] Length = 272 Score = 113 bits (285), Expect = 4e-25 Identities = 45/76 (59%), Positives = 60/76 (78%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++ FEGPLDLLL+LI + IDI DIPVA+IT+QY+ YV M+ + L++A+EYLV Sbjct: 39 DALEVFLEAFEGPLDLLLYLIRKQNIDILDIPVAEITKQYMGYVELMKTVRLELAAEYLV 98 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 99 MAAMLAEIKSRMLLPR 114 >gb|ZP_00022656.1| (NZ_AAAI01000227) hypothetical protein [Ralstonia metallidurans] Length = 343 Score = 113 bits (283), Expect = 8e-25 Identities = 39/75 (52%), Positives = 57/75 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++ FEGPLDLLL+LI + ++ DIP+A++T QYL Y+ +R L++A+EYL+ Sbjct: 104 DALEVFLEAFEGPLDLLLYLIRKQNFNVLDIPMAQVTRQYLSYIEQIRKRNLELAAEYLL 163 Query: 62 MAATLLSIKSRMLLP 76 MAA L+ IKSRMLLP Sbjct: 164 MAAMLIEIKSRMLLP 178 >gb|ZP_00083736.1| (NZ_AABA01000085) hypothetical protein [Pseudomonas fluorescens] Length = 272 Score = 111 bits (279), Expect = 2e-24 Identities = 44/76 (57%), Positives = 59/76 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++ FEGPLDLLL+LI + I+I DIPVA+IT QY+ YV M+ + L++A+EYLV Sbjct: 39 DALEVFLEAFEGPLDLLLYLIRKQNINILDIPVAEITRQYMGYVELMQSVRLELAAEYLV 98 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 99 MAAMLAEIKSRMLLPR 114 >ref|NP_692749.1| (NC_004193) hypothetical conserved protein [Oceanobacillus iheyensis] dbj|BAC13784.1| (AP004599) hypothetical conserved protein [Oceanobacillus iheyensis] Length = 249 Score = 110 bits (277), Expect = 3e-24 Identities = 61/77 (79%), Positives = 73/77 (94%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E Y+VK+DTFEGPLDLLLHLIN+ EIDIYDIPVA+IT+QY+ Y+HTM+ LEL+IASEYLV Sbjct: 3 EGYKVKLDTFEGPLDLLLHLINQFEIDIYDIPVAQITQQYMEYIHTMQHLELNIASEYLV 62 Query: 62 MAATLLSIKSRMLLPKQ 78 MA+TLL+IKS+MLLPKQ Sbjct: 63 MASTLLAIKSQMLLPKQ 79 >ref|NP_637568.1| (NC_003902) conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gb|AAM41492.1| (AE012329) conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 279 Score = 109 bits (275), Expect = 6e-24 Identities = 45/76 (59%), Positives = 59/76 (77%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R +DI DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 23 DALEVILDAFEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYINVMQELRFELAAEYLV 82 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 83 MAAILAEIKSRMLLPR 98 >gb|ZP_00012384.1| (NZ_AAAF01000001) hypothetical protein [Rhodopseudomonas palustris] Length = 342 Score = 109 bits (275), Expect = 6e-24 Identities = 32/76 (42%), Positives = 54/76 (70%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E + ++ +EGPLDLLL L + ++D++ I + + +QYLL++ R + L++A++YLV Sbjct: 87 EALVIDVEGYEGPLDLLLTLARQQKVDLHKISILALADQYLLFIEEARKIRLELAADYLV 146 Query: 62 MAATLLSIKSRMLLPK 77 MAA L +KSR+LLP+ Sbjct: 147 MAAWLAFLKSRLLLPE 162 >ref|NP_642633.1| (NC_003919) conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] gb|AAM37169.1| (AE011869) conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] Length = 279 Score = 109 bits (274), Expect = 7e-24 Identities = 45/76 (59%), Positives = 59/76 (77%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R +DI DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 23 DALEVILDAFEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYINVMQELRFELAAEYLV 82 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 83 MAAILAEIKSRMLLPR 98 >ref|NP_471399.1| (NC_003212) similar to unknown proteins [Listeria innocua] emb|CAC97295.1| (AL596170) similar to unknown proteins [Listeria innocua] Length = 249 Score = 109 bits (273), Expect = 9e-24 Identities = 56/78 (71%), Positives = 70/78 (88%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 M E K++ FEGPLDLLLHLI +LE+DIYDIP+A+IT+QY+ +VHTM+ +ELD+ASEYL Sbjct: 1 MVEMNFKVEAFEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHTMQEMELDVASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLL+IKS+MLLPKQ Sbjct: 61 VMAATLLAIKSKMLLPKQ 78 >gb|ZP_00029113.1| (NZ_AAAC01000197) hypothetical protein [Burkholderia fungorum] Length = 291 Score = 109 bits (273), Expect = 1e-23 Identities = 42/75 (56%), Positives = 57/75 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++TFEGPLDLLL+LI + ++ DIP+A +T QYL YV +R L++ASEYL+ Sbjct: 56 DALEVFLETFEGPLDLLLYLIRKQNFNVLDIPMADVTVQYLGYVDQLRQTNLELASEYLL 115 Query: 62 MAATLLSIKSRMLLP 76 MAA L+ IKSRMLLP Sbjct: 116 MAAMLIEIKSRMLLP 130 >ref|NP_520507.1| (NC_003295) CONSERVED HYPOTHETICAL PROTEIN [Ralstonia solanacearum] emb|CAD16093.1| (AL646069) CONSERVED HYPOTHETICAL PROTEIN [Ralstonia solanacearum] Length = 293 Score = 108 bits (272), Expect = 1e-23 Identities = 39/75 (52%), Positives = 57/75 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + ++ ++ FEGPLDLLL+LI R ++ DIP+A++T QYL Y+ +R L++A+EYL+ Sbjct: 54 DALEIFLEAFEGPLDLLLYLIRRQNFNVLDIPMAQVTRQYLAYIEQIRATNLELAAEYLL 113 Query: 62 MAATLLSIKSRMLLP 76 MAA L+ IKSRMLLP Sbjct: 114 MAAMLIEIKSRMLLP 128 >ref|NP_658098.1| (NC_003995) DUF173, Uncharacterized ACR, COG1354 [Bacillus anthracis A2012] [Bacillus anthracis str. A2012] Length = 247 Score = 108 bits (272), Expect = 1e-23 Identities = 58/75 (77%), Positives = 68/75 (90%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 +Y K++ FEGPLDLLLHLI+R EIDIY+IPVA+ITEQYL YVHTM+ L+LD+ASEYLVM Sbjct: 2 QYNFKVEAFEGPLDLLLHLIHRYEIDIYNIPVAEITEQYLSYVHTMKELQLDVASEYLVM 61 Query: 63 AATLLSIKSRMLLPK 77 AATLL IKS+MLLPK Sbjct: 62 AATLLQIKSKMLLPK 76 >gb|ZP_00089844.1| (NZ_AAAD01000076) hypothetical protein [Azotobacter vinelandii] Length = 268 Score = 108 bits (271), Expect = 2e-23 Identities = 44/76 (57%), Positives = 57/76 (74%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++ FEGPLDLLL+LI + IDI DIPVA+IT QY+ YV M+ L++A+EYLV Sbjct: 28 DALEVFLEAFEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYVELMKAARLELAAEYLV 87 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKS MLLP+ Sbjct: 88 MAAMLAEIKSHMLLPR 103 >gb|ZP_00067869.1| (NZ_AAAT01000027) hypothetical protein [Microbulbifer degradans 2-40] Length = 301 Score = 108 bits (271), Expect = 2e-23 Identities = 40/76 (52%), Positives = 55/76 (71%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +++F GPLDLLL+LI + IDI +I V+ IT QY+ YV M + ++A+EYLV Sbjct: 64 DALEVILESFAGPLDLLLYLIRKQNIDILEIDVSAITHQYVAYVEMMEAVHFELAAEYLV 123 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 124 MAAMLAEIKSRMLLPR 139 >gb|ZP_00003382.1| (NZ_AAAY01000001) hypothetical protein [Nitrosomonas europaea] Length = 254 Score = 108 bits (270), Expect = 2e-23 Identities = 43/76 (56%), Positives = 60/76 (78%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E Q+ ++TFEGPLDLLL+LI + +DI DIP+A++T QY+ YV TMR + ++A+EYL+ Sbjct: 18 EALQIFLETFEGPLDLLLYLIRKHNLDILDIPMAELTRQYIAYVETMRADQFELAAEYLL 77 Query: 62 MAATLLSIKSRMLLPK 77 M A L+ IKSRMLLP+ Sbjct: 78 MTALLIDIKSRMLLPR 93 >ref|NP_284420.1| (NC_003116) hypothetical protein [Neisseria meningitidis Z2491] pir||D81866 hypothetical protein NMA1705 [imported] - Neisseria meningitidis (group A strain Z2491) emb|CAB84933.1| (AL162756) hypothetical protein [Neisseria meningitidis Z2491] Length = 284 Score = 108 bits (270), Expect = 2e-23 Identities = 40/76 (52%), Positives = 58/76 (75%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V + +F+GPLDLLL+LI + ID+ DIP+ KITEQYL Y+ + + D+A+EYL+ Sbjct: 35 DALKVVLSSFQGPLDLLLYLIRKQNIDVLDIPMVKITEQYLHYIAQIETYQFDLAAEYLL 94 Query: 62 MAATLLSIKSRMLLPK 77 MAA L+ IKSR+LLP+ Sbjct: 95 MAAMLIEIKSRLLLPR 110 >ref|NP_465475.1| (NC_003210) similar to unknown proteins [Listeria monocytogenes EGD-e] emb|CAD00029.1| (AL591981) similar to unknown proteins [Listeria monocytogenes] Length = 249 Score = 108 bits (270), Expect = 2e-23 Identities = 57/78 (73%), Positives = 70/78 (89%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 M E K+D FEGPLDLLLHLI +LE+DIYDIP+A+IT+QY+ +VHTM+ +ELD+ASEYL Sbjct: 1 MVEMNFKVDAFEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHTMQEMELDVASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLL+IKS+MLLPKQ Sbjct: 61 VMAATLLAIKSKMLLPKQ 78 >ref|NP_622944.1| (NC_003869) conserved hypothetical protein [Thermoanaerobacter tengcongensis] gb|AAM24548.1| (AE013093) conserved hypothetical protein [Thermoanaerobacter tengcongensis] Length = 247 Score = 107 bits (269), Expect = 3e-23 Identities = 43/75 (57%), Positives = 61/75 (81%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 Y VK++ FEGP DLL HLI + EID+ DIP++ I +QY+ Y+ +++ ++LD+ASE++VM Sbjct: 1 MYTVKLEIFEGPFDLLFHLIEKNEIDLMDIPISIILDQYMEYIRSLQEMDLDVASEFIVM 60 Query: 63 AATLLSIKSRMLLPK 77 AATL+ IKSRMLLPK Sbjct: 61 AATLVEIKSRMLLPK 75 >ref|NP_274512.1| (NC_003112) conserved hypothetical protein [Neisseria meningitidis MC58] pir||D81075 conserved hypothetical protein NMB1504 [imported] - Neisseria meningitidis (group B strain MD58) gb|AAF41860.1| (AE002500) conserved hypothetical protein [Neisseria meningitidis MC58] Length = 284 Score = 107 bits (268), Expect = 3e-23 Identities = 40/76 (52%), Positives = 58/76 (75%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V + +F+GPLDLLL+LI + ID+ DIP+ KITEQYL Y+ + + D+A+EYL+ Sbjct: 35 DALKVVLGSFQGPLDLLLYLIRKQNIDVLDIPMVKITEQYLHYIAQIETYQFDLAAEYLL 94 Query: 62 MAATLLSIKSRMLLPK 77 MAA L+ IKSR+LLP+ Sbjct: 95 MAAMLIEIKSRLLLPR 110 >gb|ZP_00046510.1| (NZ_AAAB01000007) hypothetical protein [Lactobacillus gasseri] Length = 247 Score = 106 bits (267), Expect = 5e-23 Identities = 45/76 (59%), Positives = 55/76 (72%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 +E + + F GPLDLLLHLI +IDIYDIP+AKIT QYL + + L+L IA EY V Sbjct: 5 DELTLDLPNFTGPLDLLLHLIRSQKIDIYDIPIAKITGQYLANLARWQTLDLQIAGEYFV 64 Query: 62 MAATLLSIKSRMLLPK 77 MA+TLL IKS+ LLPK Sbjct: 65 MASTLLRIKSQYLLPK 80 >gb|ZP_00061108.1| (NZ_AAAJ01000033) hypothetical protein [Clostridium thermocellum ATCC 27405] Length = 261 Score = 106 bits (267), Expect = 6e-23 Identities = 44/75 (58%), Positives = 60/75 (79%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +KI FEGP DLL HLI + +I+IYDIP+ +IT+QY+ Y+ M+ L+L+IASE+LV Sbjct: 4 KACTIKIQNFEGPFDLLFHLIEKNQINIYDIPIHEITDQYMDYLFAMQELDLEIASEFLV 63 Query: 62 MAATLLSIKSRMLLP 76 MAATLL IKS++LLP Sbjct: 64 MAATLLHIKSKLLLP 78 >ref|NP_372019.1| (NC_002758) conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374609.1| (NC_002745) conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] ref|NP_646266.1| (NC_003923) conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] dbj|BAB42588.1| (AP003134) conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] dbj|BAB57657.1| (AP003362) conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB95314.1| (AP004827) conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] Length = 251 Score = 106 bits (267), Expect = 6e-23 Identities = 50/75 (66%), Positives = 63/75 (83%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 Y+VK+D F GPLDLLLHLI + EIDIYDIP+ +TEQY+ YVH M+ LE++IASEYLV+ Sbjct: 9 MYEVKLDAFNGPLDLLLHLIQKFEIDIYDIPMQALTEQYMQYVHAMKQLEINIASEYLVL 68 Query: 63 AATLLSIKSRMLLPK 77 A+ LL IKS+MLLP+ Sbjct: 69 ASELLMIKSKMLLPQ 83 >ref|NP_718583.1| (NC_004347) conserved hypothetical protein [Shewanella oneidensis MR-1] gb|AAN56027.1|AE015738_2 (AE015738) Shewanella oneidensis MR-1 complete genome Length = 262 Score = 106 bits (266), Expect = 7e-23 Identities = 39/76 (51%), Positives = 60/76 (78%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E +V +++FEGPLDLLL+LI + ++D+ D+P+++IT QYL Y+ + +++AS+YLV Sbjct: 30 EALEVFLESFEGPLDLLLYLIRKQKLDVVDLPISQITAQYLEYIAMLTQARIELASDYLV 89 Query: 62 MAATLLSIKSRMLLPK 77 MAATL IKSR+LLP+ Sbjct: 90 MAATLAEIKSRLLLPR 105 >ref|NP_540003.1| (NC_003317) Hypothetical Cytosolic Protein [Brucella melitensis] gb|AAL52267.1| (AE009548) Hypothetical Cytosolic Protein [Brucella melitensis] Length = 283 Score = 105 bits (264), Expect = 1e-22 Identities = 36/75 (48%), Positives = 50/75 (66%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + + FEGPLDLLLHL +D+ I V + EQYL +V R L L++A++YLVMA Sbjct: 35 LLIDVQGFEGPLDLLLHLARNQRVDLARISVLALAEQYLGFVEQARALRLELAADYLVMA 94 Query: 64 ATLLSIKSRMLLPKQ 78 A L +KS++L+PKQ Sbjct: 95 AWLAYLKSKLLIPKQ 109 >ref|NP_348680.1| (NC_003030) Uncharacterized ptotrin, YPUG B.subtilis ortholog [Clostridium acetobutylicum] gb|AAK80020.1|AE007709_4 (AE007709) Uncharacterized ptotrin, YPUG B.subtilis ortholog [Clostridium acetobutylicum] Length = 249 Score = 104 bits (262), Expect = 2e-22 Identities = 40/74 (54%), Positives = 57/74 (76%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + ID F+GP DLLLHLI + ++DIYDI + IT QY+ Y++ M+ ++L+I SE++VMA Sbjct: 3 LNINIDNFQGPFDLLLHLIRKNKMDIYDIKIFDITNQYIQYLNEMKEMDLEITSEFIVMA 62 Query: 64 ATLLSIKSRMLLPK 77 ATL+ IKS+ LLPK Sbjct: 63 ATLIEIKSKYLLPK 76 >ref|NP_251888.1| (NC_002516) conserved hypothetical protein [Pseudomonas aeruginosa PA01] pir||A83244 conserved hypothetical protein PA3198 [imported] - Pseudomonas aeruginosa (strain PAO1) gb|AAG06586.1|AE004744_1 (AE004744) conserved hypothetical protein [Pseudomonas aeruginosa PA01] Length = 250 Score = 104 bits (262), Expect = 2e-22 Identities = 45/74 (60%), Positives = 58/74 (77%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 +V ++ FEGPLDLLL+LI + IDI DIPVA+IT QY+ YV M+ + L++A+EYLVMA Sbjct: 1 MEVFLEAFEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYVELMKAVRLELAAEYLVMA 60 Query: 64 ATLLSIKSRMLLPK 77 A L IKSRMLLP+ Sbjct: 61 AMLAEIKSRMLLPR 74 >ref|NP_385632.1| (NC_003047) CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] emb|CAC46105.1| (AL591787) CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] Length = 288 Score = 103 bits (258), Expect = 5e-22 Identities = 35/76 (46%), Positives = 51/76 (67%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 +E V I FEGPLDLLLHL +D+ I V + EQY+ +V R + +++A++YLV Sbjct: 33 DELVVDIAGFEGPLDLLLHLARSQRVDLSRISVLALAEQYIAFVERARSIRIELAADYLV 92 Query: 62 MAATLLSIKSRMLLPK 77 MAA L +KSR+L+P+ Sbjct: 93 MAAWLAYLKSRLLIPQ 108 >ref|NP_102754.1| (NC_002678) hypothetical protein [Mesorhizobium loti] dbj|BAB48540.1| (AP002996) hypothetical protein [Mesorhizobium loti] Length = 285 Score = 103 bits (258), Expect = 5e-22 Identities = 37/75 (49%), Positives = 52/75 (69%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 V + FEGPLDLLLHL ++D+ I + + EQYL +V T R L L++A++YLVMA Sbjct: 37 LVVDVAGFEGPLDLLLHLARTQKVDLARISILALVEQYLAFVETARALRLELAADYLVMA 96 Query: 64 ATLLSIKSRMLLPKQ 78 A L +KS++L+PKQ Sbjct: 97 AWLAFLKSKLLIPKQ 111 >gb|ZP_00004407.1| (NZ_AAAE01000050) hypothetical protein [Rhodobacter sphaeroides] Length = 264 Score = 103 bits (257), Expect = 8e-22 Identities = 37/75 (49%), Positives = 54/75 (71%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E V ++ FEGPLDLLL L ++D+ I V K++EQYLL+V+ + L +++A++YLV Sbjct: 22 EALIVDVEGFEGPLDLLLTLSRTQKVDLRRISVLKLSEQYLLFVNHAKQLRIELAADYLV 81 Query: 62 MAATLLSIKSRMLLP 76 MAA L +KSR+LLP Sbjct: 82 MAAWLAYLKSRLLLP 96 >ref|NP_354696.1| (NC_003062) AGR_C_3139p [Agrobacterium tumefaciens] [Agrobacterium tumefaciens str. C58 (Cereon)] ref|NP_532392.1| (NC_003304) conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] gb|AAK87481.1| (AE008092) AGR_C_3139p [Agrobacterium tumefaciens str. C58 (Cereon)] gb|AAL42708.1| (AE009127) conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 281 Score = 103 bits (257), Expect = 8e-22 Identities = 33/76 (43%), Positives = 52/76 (68%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 + + FEGPLDLLLHL ++D+ I V + EQYL +V + R + +++A++YLVM Sbjct: 29 GLVIDVAGFEGPLDLLLHLARTQKVDLSRISVLALAEQYLQFVESARRVRIELAADYLVM 88 Query: 63 AATLLSIKSRMLLPKQ 78 AA L +KS++L+P+Q Sbjct: 89 AAWLAFLKSKLLIPQQ 104 >ref|NP_562721.1| (NC_003366) conserved hypothetical protein [Clostridium perfringens] dbj|BAB81511.1| (AP003191) conserved hypothetical protein [Clostridium perfringens str. 13] Length = 248 Score = 102 bits (256), Expect = 9e-22 Identities = 41/77 (53%), Positives = 58/77 (75%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 ME +K+ F+GP DLLLHLI + E+ I +I + +IT+QYL Y+ M+ L+L+I SE++ Sbjct: 1 MEMPIIKLKNFDGPFDLLLHLIKKNEMSITEIKIHEITKQYLEYIALMKELDLEITSEFI 60 Query: 61 VMAATLLSIKSRMLLPK 77 VMAATL+ IKS+ LLPK Sbjct: 61 VMAATLIEIKSKSLLPK 77 >ref|NP_661042.1| (NC_002932) conserved hypothetical protein [Chlorobium tepidum TLS] gb|AAM71384.1| (AE012792) conserved hypothetical protein [Chlorobium tepidum TLS] Length = 242 Score = 102 bits (255), Expect = 1e-21 Identities = 39/75 (52%), Positives = 60/75 (80%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 +++ ++ FEGPLDLLL I R E+DIY+IP++KIT ++ Y+H MR L L++A+E++ M Sbjct: 1 MFRISLEEFEGPLDLLLFFIKRDELDIYNIPISKITGDFIAYIHAMRRLNLEVAAEFIYM 60 Query: 63 AATLLSIKSRMLLPK 77 A+ L+SIK+RMLLP+ Sbjct: 61 ASMLMSIKARMLLPR 75 >ref|NP_722042.1| (NC_004350) conserved hypothetical protein [Streptococcus mutans UA159] gb|AAN59348.1|AE015000_6 (AE015000) conserved hypothetical protein [Streptococcus mutans UA159] Length = 235 Score = 100 bits (250), Expect = 5e-21 Identities = 41/72 (56%), Positives = 59/72 (81%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ E+DIYD+P+ I EQYL Y+ T++ ++L++A EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYEVDIYDVPIVDIIEQYLAYIATLQAMKLEVAGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >gb|ZP_00064299.1| (NZ_AAAO01000066) hypothetical protein [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] Length = 258 Score = 100 bits (250), Expect = 5e-21 Identities = 41/77 (53%), Positives = 59/77 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 +K+ FEGP+DLLLHLI + E++I+D+ +A IT QYL ++H + ++LD+ASEYLV Sbjct: 9 NGLTIKLSDFEGPIDLLLHLIKKSEMNIFDLKIADITSQYLDFIHAQQAMQLDVASEYLV 68 Query: 62 MAATLLSIKSRMLLPKQ 78 MAATL+ IKS LLP++ Sbjct: 69 MAATLVKIKSADLLPEE 85 >ref|NP_688586.1| (NC_004116) conserved hypothetical protein [Streptococcus agalactiae 2603V/R] gb|AAN00459.1|AE014264_14 (AE014264) conserved hypothetical protein [Streptococcus agalactiae 2603V/R] Length = 235 Score = 99.6 bits (248), Expect = 8e-21 Identities = 39/72 (54%), Positives = 59/72 (81%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ E+DIYD+P+ ++ EQYL Y+ T++ + L++A EY++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYEVDIYDVPIVEVIEQYLAYIATLQAMRLEVAGEYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRNLLPK 74 >emb|CAD47303.1| (AL766852) unknown [Streptococcus agalactiae] Length = 235 Score = 99.6 bits (248), Expect = 9e-21 Identities = 39/72 (54%), Positives = 59/72 (81%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ E+DIYD+P+ ++ EQYL Y+ T++ + L++A EY++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYEVDIYDVPIVEVIEQYLAYIATLQAMRLEVAGEYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRNLLPK 74 >ref|NP_697893.1| (NC_004310) conserved hypothetical protein [Brucella suis 1330] gb|AAN29808.1|AE014391_3 (AE014391) conserved hypothetical protein [Brucella suis 1330] Length = 245 Score = 98.8 bits (246), Expect = 2e-20 Identities = 36/69 (52%), Positives = 48/69 (69%) Query: 10 TFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSI 69 FEGPLDLLLHL +D+ I V + EQYL +V R L L++A++YLVMAA L + Sbjct: 3 GFEGPLDLLLHLARNQRVDLARISVLALAEQYLGFVEQARALRLELAADYLVMAAWLAYL 62 Query: 70 KSRMLLPKQ 78 KS++L+PKQ Sbjct: 63 KSKLLIPKQ 71 >ref|NP_606660.1| (NC_003485) conserved hypothetical protein [Streptococcus pyogenes MGAS8232] gb|AAL97159.1| (AE009983) conserved hypothetical protein [Streptococcus pyogenes MGAS8232] Length = 234 Score = 98.0 bits (244), Expect = 2e-20 Identities = 37/72 (51%), Positives = 61/72 (84%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIY++P+ ++ EQYL Y+ T++V++L++A +Y++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETLQVMKLEVAGDYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRRLLPK 74 >ref|NP_664071.1| (NC_004070) conserved hypothetical protein [Streptococcus pyogenes MGAS315] gb|AAM78874.1| (AE014141) conserved hypothetical protein [Streptococcus pyogenes MGAS315] Length = 234 Score = 97.7 bits (243), Expect = 4e-20 Identities = 37/72 (51%), Positives = 61/72 (84%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIY++P+ ++ EQYL Y+ T++V++L++A +Y++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETLQVMKLEVAGDYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRRLLPK 74 >ref|NP_268690.1| (NC_002737) conserved hypothetical protein [Streptococcus pyogenes] [Streptococcus pyogenes M1 GAS] gb|AAK33411.1| (AE006500) conserved hypothetical protein [Streptococcus pyogenes M1 GAS] Length = 233 Score = 97.3 bits (242), Expect = 4e-20 Identities = 37/72 (51%), Positives = 61/72 (84%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIY++P+ ++ EQYL Y+ T++V++L++A +Y++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETLQVMKLEVAGDYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRRLLPK 74 >emb|CAC19444.1| (AJ277490) hypothetical protein [Streptococcus mitis] Length = 242 Score = 96.9 bits (241), Expect = 5e-20 Identities = 39/72 (54%), Positives = 58/72 (80%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIYD+P+ ++ EQYL YV T++ + L++ EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYKMDIYDVPITEVIEQYLAYVSTLQAMRLEVTGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >gb|ZP_00117780.1| (NZ_AABE01000041) hypothetical protein [Cytophaga hutchinsonii] Length = 262 Score = 96.5 bits (240), Expect = 8e-20 Identities = 36/74 (48%), Positives = 57/74 (76%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 +++++ F GP DLLL I R E+DIYDIP++KIT +L Y+H + + +DIASE++++A Sbjct: 7 FEIQLPLFAGPFDLLLFFIERDELDIYDIPISKITNDFLEYIHRLEKMNVDIASEFILVA 66 Query: 64 ATLLSIKSRMLLPK 77 ATL+ IK++ LLP+ Sbjct: 67 ATLMRIKAKTLLPR 80 >gb|ZP_00070137.1| (NZ_AAAZ01000010) hypothetical protein [Oenococcus oeni MCW] Length = 247 Score = 96.1 bits (239), Expect = 8e-20 Identities = 39/75 (52%), Positives = 54/75 (72%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 ++ + +D F GPLDLLLHLI E+DI+D+P+AK+T+Q+L ++ LD A EYL Sbjct: 4 KQLTISLDDFSGPLDLLLHLIRTQELDIFDLPIAKVTDQFLSFIDNQLNPSLDSAGEYLY 63 Query: 62 MAATLLSIKSRMLLP 76 MA+TL+ IKSR LLP Sbjct: 64 MASTLIRIKSRFLLP 78 >ref|NP_346308.1| (NC_003028) conserved hypothetical protein [Streptococcus pneumoniae TIGR4] gb|AAK75948.1| (AE007478) conserved hypothetical protein [Streptococcus pneumoniae TIGR4] Length = 242 Score = 96.1 bits (239), Expect = 9e-20 Identities = 39/72 (54%), Positives = 58/72 (80%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIYD+P+ ++ EQYL YV T++ + L++ EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVSTLQAMRLEVTGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >ref|NP_359283.1| (NC_003098) Conserved hypothetical protein [Streptococcus pneumoniae R6] emb|CAC19449.1| (AJ277766) hypothetical protein [Streptococcus pneumoniae] gb|AAL00494.1| (AE008534) Conserved hypothetical protein [Streptococcus pneumoniae R6] Length = 242 Score = 96.1 bits (239), Expect = 1e-19 Identities = 39/72 (54%), Positives = 58/72 (80%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIYD+P+ ++ EQYL YV T++ + L++ EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVSTLQAMRLEVTGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >ref|NP_219128.1| (NC_000919) conserved hypothetical protein [Treponema pallidum] pir||H71292 conserved hypothetical protein TP0691 - syphilis spirochete gb|AAC65659.1| (AE001243) conserved hypothetical protein [Treponema pallidum] Length = 252 Score = 95.3 bits (237), Expect = 1e-19 Identities = 39/74 (52%), Positives = 49/74 (65%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 + K+ FEGPLDLLL LI + E+ IYDIP+ +IT QYL YV +L +E+ MAA Sbjct: 12 EFKLSQFEGPLDLLLFLIKKNELSIYDIPICEITAQYLQYVDQTVSPDLRGLTEFYAMAA 71 Query: 65 TLLSIKSRMLLPKQ 78 LL IKS MLLP + Sbjct: 72 VLLYIKSCMLLPME 85 >ref|NP_267433.1| (NC_002662) HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis] gb|AAK05375.1|AE006360_4 (AE006360) HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis] Length = 242 Score = 95.0 bits (236), Expect = 2e-19 Identities = 41/76 (53%), Positives = 62/76 (80%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 ++E +KI FEGPLDLLLHL+++ E+DI+++P+ + EQYL+Y+ TM+ LEL++A EY+ Sbjct: 2 IKEINIKIKNFEGPLDLLLHLVSQYEMDIFEVPLVPVIEQYLIYIQTMKELELEVAGEYM 61 Query: 61 VMAATLLSIKSRMLLP 76 +MA+ L+ IKSR LLP Sbjct: 62 LMASQLMLIKSRRLLP 77 >ref|NP_420812.1| (NC_002696) conserved hypothetical protein [Caulobacter crescentus CB15] gb|AAK23980.1| (AE005874) conserved hypothetical protein [Caulobacter crescentus CB15] Length = 274 Score = 94.6 bits (235), Expect = 2e-19 Identities = 31/75 (41%), Positives = 48/75 (63%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 + ID +EGPL +LL L ++D+ + + ++ EQYL +V R + +A++YLVM Sbjct: 23 ALVIDIDGYEGPLHVLLALARSQKVDLLQLSITRLAEQYLAFVQQARRVRFALAADYLVM 82 Query: 63 AATLLSIKSRMLLPK 77 AA L +KSR+LLPK Sbjct: 83 AAWLAYLKSRLLLPK 97 >ref|NP_228303.1| (NC_000853) conserved hypothetical protein [Thermotoga maritima] pir||D72370 conserved hypothetical protein - Thermotoga maritima (strain MSB8) gb|AAD35578.1|AE001726_12 (AE001726) conserved hypothetical protein [Thermotoga maritima] Length = 229 Score = 94.2 bits (234), Expect = 3e-19 Identities = 30/74 (40%), Positives = 57/74 (76%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 K+ FEGPLDLLL+L+ + ++DI +IP++++ ++++ Y+ M+ L++ I S++L MA Sbjct: 3 LVFKLPVFEGPLDLLLYLVRKKKVDIREIPISQLADEFVEYLEHMKKLDMKITSDFLEMA 62 Query: 64 ATLLSIKSRMLLPK 77 +TL+ +KS+ML+P+ Sbjct: 63 STLMELKSKMLIPR 76 >gb|ZP_00057587.1| (NZ_AAAQ01000029) hypothetical protein [Thermobifida fusca] Length = 274 Score = 93.4 bits (232), Expect = 6e-19 Identities = 29/76 (38%), Positives = 54/76 (70%), Gaps = 1/76 (1%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMR-VLELDIASEYLV 61 + V +D FEGP DLLL LI++ ++DI ++ ++K+T++++ ++ +LD+ S +L+ Sbjct: 10 GFLVHLDNFEGPFDLLLTLISKHKLDITEVALSKVTDEFIAHIKAYEDSWDLDMVSNFLL 69 Query: 62 MAATLLSIKSRMLLPK 77 +AATLL +K+ LLP+ Sbjct: 70 VAATLLDLKAARLLPR 85 >ref|NP_301976.1| (NC_002677) conserved hypothetical protein [Mycobacterium leprae] pir||S72957 hypothetical protein - Mycobacterium leprae gb|AAA50910.1| (U00021) unknown [Mycobacterium leprae] emb|CAB08281.1| (Z95117) hypothetical protein MLC1351.05c [Mycobacterium leprae] emb|CAC31749.1| (AL583921) conserved hypothetical protein [Mycobacterium leprae] Length = 268 Score = 93.0 bits (231), Expect = 8e-19 Identities = 28/76 (36%), Positives = 50/76 (64%), Gaps = 1/76 (1%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMR-VLELDIASEYL 60 +QV++ FEGP DLLLHLI +D+ ++ + ++T+ ++ Y+ + L L+ + +L Sbjct: 9 NGFQVRLTNFEGPFDLLLHLICAHRLDVTEVALHQVTDDFIAYIRRLGPQLGLEETTAFL 68 Query: 61 VMAATLLSIKSRMLLP 76 V+AATL+ +K+ LLP Sbjct: 69 VIAATLIDLKAARLLP 84 >gb|ZP_00054139.1| (NZ_AAAP01003810) hypothetical protein [Magnetospirillum magnetotacticum] Length = 272 Score = 91.5 bits (227), Expect = 2e-18 Identities = 30/71 (42%), Positives = 47/71 (65%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E + +D +EGPLD+LL L ++D+ I + K+ +QYL +V + ++D+A+EYLV Sbjct: 22 ERLLLDLDGWEGPLDVLLQLARDQKVDLAKISILKLADQYLDFVRKVGREQIDLAAEYLV 81 Query: 62 MAATLLSIKSR 72 MAA L +KSR Sbjct: 82 MAAWLAYLKSR 92 >ref|NP_600640.2| (NC_003450) hypothetical protein [Corynebacterium glutamicum ATCC 13032] dbj|BAB98815.1| (AP005278) Uncharacterized ACR [Corynebacterium glutamicum ATCC 13032] Length = 255 Score = 90.7 bits (225), Expect = 3e-18 Identities = 29/73 (39%), Positives = 53/73 (71%), Gaps = 1/73 (1%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVL-ELDIASEYLVMAA 64 +++D FEGP DLLL LI + ++D+ ++ +A++T++++ Y + +LD +E+LV+AA Sbjct: 1 MQLDNFEGPFDLLLQLITKKKLDVTEVALAQVTDEFIAYTRKLGETSDLDETTEFLVVAA 60 Query: 65 TLLSIKSRMLLPK 77 TLL +K+ LLP+ Sbjct: 61 TLLDLKTARLLPR 73 >ref|NP_626041.1| (NC_003888) conserved hypothetical protein [Streptomyces coelicolor A3(2)] pir||T36873 hypothetical protein SCI51.10c - Streptomyces coelicolor emb|CAB52834.1| (AL939110) conserved hypothetical protein [Streptomyces coelicolor A3(2)] Length = 264 Score = 88.8 bits (220), Expect = 1e-17 Identities = 28/72 (38%), Positives = 53/72 (72%), Gaps = 1/72 (1%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMR-VLELDIASEYLVMAA 64 +++ FEGP DLLL LI++ ++D+ ++ ++K+T++++ ++ M +LD +E+LV+AA Sbjct: 1 MRLANFEGPFDLLLQLISKHKLDVTEVALSKVTDEFMAHIRAMGPDWDLDQTTEFLVVAA 60 Query: 65 TLLSIKSRMLLP 76 TLL +K+ LLP Sbjct: 61 TLLDLKAARLLP 72 >gb|ZP_00017702.1| (NZ_AAAH01000167) hypothetical protein [Chloroflexus aurantiacus] Length = 248 Score = 87.3 bits (216), Expect = 4e-17 Identities = 36/74 (48%), Positives = 49/74 (65%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 Y V + F GPLDLLL LI R E+DI I +A + +QYL +V T+ +E +E++ MA Sbjct: 3 YAVTLPEFTGPLDLLLRLIERAELDITTIALASVADQYLAHVRTLEEVEPRELAEFVSMA 62 Query: 64 ATLLSIKSRMLLPK 77 A L+ IKSR LLP+ Sbjct: 63 ARLILIKSRALLPR 76 >ref|NP_216225.1| (NC_000962) hypothetical protein Rv1709 [Mycobacterium tuberculosis H37Rv] ref|NP_336206.1| (NC_002755) conserved hypothetical protein [Mycobacterium tuberculosis CDC1551] pir||D70504 hypothetical protein Rv1709 - Mycobacterium tuberculosis (strain H37RV) emb|CAB10966.1| (Z98268) hypothetical protein Rv1709 [Mycobacterium tuberculosis H37Rv] gb|AAK46020.1| (AE007037) conserved hypothetical protein [Mycobacterium tuberculosis CDC1551] Length = 278 Score = 86.5 bits (214), Expect = 6e-17 Identities = 28/75 (37%), Positives = 50/75 (66%), Gaps = 1/75 (1%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMR-VLELDIASEYLV 61 ++V++ FEGP DLLL LI ++D+ ++ + ++T+ ++ Y + LEL+ + +LV Sbjct: 22 GFRVRLTNFEGPFDLLLQLIFAHQLDVTEVALHQVTDDFIAYTKAIGARLELEETTAFLV 81 Query: 62 MAATLLSIKSRMLLP 76 +AATLL +K+ LLP Sbjct: 82 IAATLLDLKAARLLP 96 >gb|ZP_00094099.1| (NZ_AAAV01000112) hypothetical protein [Novosphingobium aromaticivorans] Length = 265 Score = 86.5 bits (214), Expect = 7e-17 Identities = 32/75 (42%), Positives = 52/75 (68%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 +++D +EGPLDLLL L R ++D+ I + ++ +QYL Y+ L+L++A++YLVM Sbjct: 28 ALYLELDGWEGPLDLLLELARRQKVDLRKISILELVDQYLGYIEQAEALKLELAADYLVM 87 Query: 63 AATLLSIKSRMLLPK 77 AA L +KS +LLP+ Sbjct: 88 AAWLAYLKSLLLLPR 102 >ref|NP_603605.1| (NC_003454) Hypothetical cytosolic protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gb|AAL94904.1| (AE010581) Hypothetical cytosolic protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] Length = 225 Score = 83.4 bits (206), Expect = 6e-16 Identities = 28/75 (37%), Positives = 52/75 (69%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 MEE VK++ FEGP DLLL+LI + ++ I DI ++++ ++YL + + ++I S+++ Sbjct: 1 MEEVVVKLNNFEGPFDLLLNLIEKNKMKISDINISQLIDEYLEVLRVSKRENIEIKSDFI 60 Query: 61 VMAATLLSIKSRMLL 75 ++A+ L+ IK+ LL Sbjct: 61 IIASELIEIKTLNLL 75 >ref|NP_325946.1| (NC_002771) conserved hypothetical protein [Mycoplasma pulmonis] emb|CAC13288.1| (AL445563) conserved hypothetical protein [Mycoplasma pulmonis] Length = 249 Score = 81.1 bits (200), Expect = 3e-15 Identities = 33/74 (44%), Positives = 47/74 (62%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 I F GPLDLLL L+ IDI++I + ++ QYL + ++ ++D+AS+YLV Sbjct: 8 NGPVFNIKNFSGPLDLLLSLVKDKNIDIFEINLVELATQYLEIIKKLQDDKIDLASDYLV 67 Query: 62 MAATLLSIKSRMLL 75 MAATLL IK+ M L Sbjct: 68 MAATLLQIKASMAL 81 >gb|ZP_00016048.1| (NZ_AAAG01000012) hypothetical protein [Rhodospirillum rubrum] Length = 236 Score = 81.1 bits (200), Expect = 3e-15 Identities = 24/60 (40%), Positives = 40/60 (66%) Query: 17 LLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRMLLP 76 +LL L ++D+ + + ++ EQYL +V R + L++A +YLVMAA L +KSR+L+P Sbjct: 1 MLLTLARSQKVDLTKLSILRLAEQYLAFVARARQIHLELAGDYLVMAAWLAYLKSRLLIP 60 >ref|NP_696536.1| (NC_004307) narrowly conserved hypothetical protein [Bifidobacterium longum NCC2705] gb|AAN25172.1|AE014767_3 (AE014767) narrowly conserved hypothetical protein [Bifidobacterium longum NCC2705] Length = 304 Score = 78.8 bits (194), Expect = 1e-14 Identities = 24/75 (32%), Positives = 46/75 (61%), Gaps = 1/75 (1%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVL-ELDIASEYLV 61 +QV ++ + GP D LL +I ++++ ++ ++ ITE++L YV + +D AS +L Sbjct: 39 GFQVNLEVYSGPFDALLGMIANNKLELTEVSLSSITEEFLTYVRGLDFTKNMDEASAFLD 98 Query: 62 MAATLLSIKSRMLLP 76 +A+ L+ KS +LP Sbjct: 99 IASILVEAKSVAILP 113 >gb|ZP_00120635.1| (NZ_AABF01000003) hypothetical protein [Bifidobacterium longum DJO10A] Length = 304 Score = 78.0 bits (192), Expect = 2e-14 Identities = 23/75 (30%), Positives = 46/75 (60%), Gaps = 1/75 (1%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVL-ELDIASEYLV 61 ++V ++ + GP D LL +I ++++ ++ ++ ITE++L YV + +D AS +L Sbjct: 39 GFRVNLEVYSGPFDALLGMIANNKLELTEVSLSSITEEFLTYVRGLDFTKNMDEASAFLD 98 Query: 62 MAATLLSIKSRMLLP 76 +A+ L+ KS +LP Sbjct: 99 IASILVEAKSVAILP 113 >ref|NP_711435.1| (NC_004342) conserved hypothetical protein [Leptospira interrogans serovar lai str. 56601] gb|AAN48453.1|AE011307_6 (AE011307) conserved hypothetical protein [Leptospira interrogans serovar lai str. 56601] Length = 261 Score = 77.6 bits (191), Expect = 3e-14 Identities = 26/65 (40%), Positives = 45/65 (69%) Query: 12 EGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKS 71 EGPL +L LI ++DI+D+ +++IT +L ++ L L++++EY +MAA L+ +KS Sbjct: 23 EGPLSVLWSLIESYKVDIFDVSLSRITRDFLSFLRISETLSLELSAEYALMAANLIYLKS 82 Query: 72 RMLLP 76 + LLP Sbjct: 83 KALLP 87 >ref|NP_078179.1| (NC_002162) conserved hypothetical [Ureaplasma urealyticum] pir||F82903 conserved hypothetical UU345 [imported] - Ureaplasma urealyticum gb|AAF30754.1|AE002131_8 (AE002131) conserved hypothetical [Ureaplasma urealyticum] Length = 294 Score = 77.2 bits (190), Expect = 5e-14 Identities = 26/74 (35%), Positives = 51/74 (68%), Gaps = 1/74 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTM-RVLELDIASEYLVM 62 ++ K F GPLD L LI + +DI ++ + ++++QY+ +V+ + + +++DI ++L M Sbjct: 14 FEYKFIDFNGPLDTLCVLIKQKRLDINNLDILELSKQYVNFVNQLIKTIDIDILGDHLAM 73 Query: 63 AATLLSIKSRMLLP 76 A+ LL +K+RML+P Sbjct: 74 ASYLLELKTRMLMP 87 >ref|NP_619196.1| (NC_003552) conserved hypothetical protein [Methanosarcina acetivorans str. C2A] [Methanosarcina acetivorans C2A] gb|AAM07676.1| (AE011151) conserved hypothetical protein [Methanosarcina acetivorans str. C2A] [Methanosarcina acetivorans C2A] Length = 361 Score = 73.8 bits (181), Expect = 5e-13 Identities = 23/72 (31%), Positives = 43/72 (58%), Gaps = 2/72 (2%) Query: 6 VKIDTFEG--PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + + F PL +L+ L +ID +DI V ++T+ +L V ++ ++L I+S L+ + Sbjct: 53 LDLSEFNTYEPLGILVELAKDGKIDPWDIDVVQLTDSFLQRVEELQKMDLRISSRTLLYS 112 Query: 64 ATLLSIKSRMLL 75 A LL +KS ++L Sbjct: 113 AILLRMKSSVIL 124 >gb|ZP_00078476.1| (NZ_AAAR01001933) hypothetical protein [Methanosarcina barkeri] Length = 339 Score = 73.0 bits (179), Expect = 8e-13 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Query: 6 VKIDTFEG--PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + I FE PL +L+ L +ID +DI + ++T+ +L V ++ ++L I+S L+ + Sbjct: 54 LDISEFETSEPLGILVELARVGKIDPWDIDIVQLTDGFLRKVEELKQMDLRISSRTLLYS 113 Query: 64 ATLLSIKSRMLL 75 A LL +KS +L Sbjct: 114 AILLRMKSSGIL 125 >ref|NP_633054.1| (NC_003901) conserved protein [Methanosarcina mazei Goe1] gb|AAM30726.1| (AE013329) conserved protein [Methanosarcina mazei Goe1] Length = 334 Score = 72.2 bits (177), Expect = 1e-12 Identities = 21/72 (29%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Query: 6 VKIDTFEG--PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + + F PL +L+ L +ID +DI V ++T+ +L + ++ ++L I+S L+ + Sbjct: 52 LDLSEFNTCEPLGILVELAKDGKIDPWDIDVVQLTDNFLRRIEELQKMDLRISSRTLLYS 111 Query: 64 ATLLSIKSRMLL 75 A LL +KS +++ Sbjct: 112 AILLRMKSSVIM 123 >ref|NP_109988.1| (NC_000912) bidomainal:Dihydrofolate Reductase and C-terminal domain is conserved hypo-thetical [Mycoplasma pneumoniae] sp|P75478|Y213_MYCPN Hypothetical protein MG213 homolog (H10_orf506) pir||S73862 dihyrofolate reductase homolog H10_orf506 - Mycoplasma pneumoniae (strain ATCC 29342) gb|AAB96184.1| (AE000052) bidomainal:Dihydrofolate Reductase and C-terminal domain is conserved hypo-thetical [Mycoplasma pneumoniae] Length = 506 Score = 71.8 bits (176), Expect = 2e-12 Identities = 20/73 (27%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHT-MRVLELDIASEYLVM 62 + V ++ + G L LL L+ + +++ + +AKIT QYL ++T + ++ ++YLV+ Sbjct: 161 FNVFLEDYNGTLPNLLELLIDKKFNLHQVDIAKITTQYLHLINTNLNKQAIEPITDYLVI 220 Query: 63 AATLLSIKSRMLL 75 + ++ K+ LL Sbjct: 221 TSRIVEQKANNLL 233 >ref|NP_126049.1| (NC_000868) hypothetical protein [Pyrococcus abyssi] pir||A75150 hypothetical protein PAB2110 - Pyrococcus abyssi (strain Orsay) emb|CAB49280.1| (AJ248284) Hypothetical protein [Pyrococcus abyssi] Length = 218 Score = 71.1 bits (174), Expect = 3e-12 Identities = 22/75 (29%), Positives = 47/75 (62%), Gaps = 4/75 (5%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 ME ++ ++ P+D+LL L+ ++D ++I + +TE+Y+ + M+ L+L I++ + Sbjct: 1 MERFEPEVT----PVDILLQLVKMGKVDPWNIDIVDLTEKYIKMLREMQELDLRISARAI 56 Query: 61 VMAATLLSIKSRMLL 75 + A+ L+ +KS LL Sbjct: 57 LAASILVRMKSEALL 71 >ref|NP_143634.1| (NC_000961) hypothetical protein [Pyrococcus horikoshii] pir||E71190 hypothetical protein PH1797 - Pyrococcus horikoshii Length = 213 Score = 67.6 bits (165), Expect = 4e-11 Identities = 20/62 (32%), Positives = 41/62 (65%) Query: 14 PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRM 73 P+D+LL L+ ++D ++I + +TE+Y+ + M+ L+L I++ ++ A+ L+ +KS Sbjct: 8 PVDILLQLVKMGKVDPWNIDIVDLTEKYIKMLREMQELDLRISARAILAASILVRMKSEA 67 Query: 74 LL 75 LL Sbjct: 68 LL 69 >ref|NP_579571.1| (NC_003413) hypothetical protein [Pyrococcus furiosus DSM 3638] gb|AAL81966.1| (AE010280) hypothetical protein [Pyrococcus furiosus DSM 3638] Length = 212 Score = 58.0 bits (140), Expect = 3e-08 Identities = 21/62 (33%), Positives = 41/62 (65%) Query: 14 PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRM 73 P+D+LL L+ ++D ++I + +TE+Y+ + M+ L+L I++ ++ AA L+ +KS Sbjct: 7 PVDILLQLVKMGKVDPWNIDIVDLTEKYIKMLREMQELDLRISARAILAAAILVRMKSEA 66 Query: 74 LL 75 LL Sbjct: 67 LL 68 >ref|NP_279432.1| (NC_002607) Vng0340c [Halobacterium sp. NRC-1] gb|AAG18912.1| (AE004993) Vng0340c [Halobacterium sp. NRC-1] Length = 286 Score = 54.9 bits (132), Expect = 2e-07 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 3/62 (4%) Query: 14 PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRM 73 P+ +L+ L R EI+ +DI + +T+++L + +L + L A+ LL +KS Sbjct: 27 PVAVLVRLAERGEIEPWDIDIVAVTDKFLA---ALDEADLRTSGRALFYASVLLRMKSEA 83 Query: 74 LL 75 +L Sbjct: 84 ML 85 >ref|NP_070388.1| (NC_000917) conserved hypothetical protein [Archaeoglobus fulgidus] pir||F69444 conserved hypothetical protein AF1559 - Archaeoglobus fulgidus gb|AAB89689.1| (AE000995) conserved hypothetical protein [Archaeoglobus fulgidus] Length = 224 Score = 51.8 bits (124), Expect = 2e-06 Identities = 15/54 (27%), Positives = 32/54 (58%) Query: 21 LINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRML 74 + R EID ++I V +T+++L + + L+L ++ L+ AA L+ +K+ + Sbjct: 1 MAKRGEIDPWNIDVVDVTDRFLKRIEDAKKLDLRVSGRVLLYAAILVRMKAEAI 54 >ref|NP_248126.1| (NC_000909) conserved hypothetical protein [Methanococcus jannaschii] [Methanocaldococcus jannaschii] pir||E64441 hypothetical protein MJ1134 - Methanococcus jannaschii gb|AAB99136.1| (U67556) conserved hypothetical protein [Methanococcus jannaschii] [Methanocaldococcus jannaschii] Length = 226 Score = 51.0 bits (122), Expect = 3e-06 Identities = 11/53 (20%), Positives = 33/53 (61%) Query: 22 INRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRML 74 I + ++ +D+ +A+I + Y+ + ++ ++ ++++ +++A LL +KS L Sbjct: 19 IEKKNLNPWDVNIAEIADYYIQKIKELKKFDIRLSADVILVAGILLRMKSEAL 71 >ref|NP_213299.1| (NC_000918) hypothetical protein [Aquifex aeolicus] pir||G70338 conserved hypothetical protein aq_423 - Aquifex aeolicus gb|AAC06703.1| (AE000689) hypothetical protein [Aquifex aeolicus] Length = 205 Score = 50.7 bits (121), Expect = 5e-06 Identities = 17/66 (25%), Positives = 36/66 (53%) Query: 12 EGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKS 71 E P L+L LI ++D +++ + ++ Y+ + + VL+L + + ++ A+ LL K Sbjct: 9 EHPFSLVLPLIEEGKLDPWEVDIVELANLYMEELKKLEVLDLRVPARAILAASFLLRKKI 68 Query: 72 RMLLPK 77 + PK Sbjct: 69 ETIFPK 74 >ref|NP_682448.1| (NC_004113) ORF_ID:tll1658~hypothetical protein [Thermosynechococcus elongatus BP-1] dbj|BAC09210.1| (AP005374) ORF_ID:tll1658~hypothetical protein [Thermosynechococcus elongatus BP-1] Length = 254 Score = 46.8 bits (111), Expect = 7e-05 Identities = 18/59 (30%), Positives = 30/59 (50%) Query: 16 DLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRML 74 D+L+ L R EID +DI V + ++ L + L + + + AA L+ +KS L Sbjct: 23 DILIELAERGEIDPWDIQVVDVCDRCLAELARRGEPNLSESGQAFLYAAMLVLLKSDRL 81 Searching..................................................done Results from round 4 Score E Sequences producing significant alignments: (bits) Value Sequences used in model and found again: ref|NP_242426.1| (NC_002570) BH1560~unknown conserved protein [B... 116 5e-26 gb|ZP_00081131.1| (NZ_AAAS01000008) hypothetical protein [Geobac... 116 5e-26 ref|NP_390203.1| (NC_000964) similar to hypothetical proteins [B... 114 2e-25 gb|ZP_00041528.1| (NZ_AAAM01000048) hypothetical protein [Xylell... 113 5e-25 gb|ZP_00038779.1| (NZ_AAAL01000087) hypothetical protein [Xylell... 113 5e-25 ref|NP_299730.1| (NC_002488) conserved hypothetical protein [Xyl... 113 7e-25 gb|ZP_00127918.1| (NZ_AABH01000012) hypothetical protein [Pseudo... 111 1e-24 gb|ZP_00022656.1| (NZ_AAAI01000227) hypothetical protein [Ralsto... 111 2e-24 ref|NP_692749.1| (NC_004193) hypothetical conserved protein [Oce... 111 3e-24 gb|ZP_00083736.1| (NZ_AABA01000085) hypothetical protein [Pseudo... 109 6e-24 ref|NP_637568.1| (NC_003902) conserved hypothetical protein [Xan... 108 2e-23 ref|NP_471399.1| (NC_003212) similar to unknown proteins [Lister... 108 2e-23 ref|NP_658098.1| (NC_003995) DUF173, Uncharacterized ACR, COG135... 108 2e-23 gb|ZP_00029113.1| (NZ_AAAC01000197) hypothetical protein [Burkho... 108 2e-23 ref|NP_520507.1| (NC_003295) CONSERVED HYPOTHETICAL PROTEIN [Ral... 108 2e-23 ref|NP_642633.1| (NC_003919) conserved hypothetical protein [Xan... 108 2e-23 gb|ZP_00012384.1| (NZ_AAAF01000001) hypothetical protein [Rhodop... 107 3e-23 gb|ZP_00089844.1| (NZ_AAAD01000076) hypothetical protein [Azotob... 107 3e-23 gb|ZP_00067869.1| (NZ_AAAT01000027) hypothetical protein [Microb... 107 4e-23 ref|NP_465475.1| (NC_003210) similar to unknown proteins [Lister... 107 5e-23 ref|NP_622944.1| (NC_003869) conserved hypothetical protein [The... 107 5e-23 gb|ZP_00046510.1| (NZ_AAAB01000007) hypothetical protein [Lactob... 106 5e-23 ref|NP_284420.1| (NC_003116) hypothetical protein [Neisseria men... 106 6e-23 gb|ZP_00003382.1| (NZ_AAAY01000001) hypothetical protein [Nitros... 106 6e-23 gb|ZP_00061108.1| (NZ_AAAJ01000033) hypothetical protein [Clostr... 106 6e-23 ref|NP_372019.1| (NC_002758) conserved hypothetical protein [Sta... 106 7e-23 ref|NP_274512.1| (NC_003112) conserved hypothetical protein [Nei... 105 1e-22 ref|NP_348680.1| (NC_003030) Uncharacterized ptotrin, YPUG B.sub... 104 2e-22 ref|NP_718583.1| (NC_004347) conserved hypothetical protein [She... 104 2e-22 ref|NP_251888.1| (NC_002516) conserved hypothetical protein [Pse... 103 4e-22 ref|NP_540003.1| (NC_003317) Hypothetical Cytosolic Protein [Bru... 103 5e-22 ref|NP_562721.1| (NC_003366) conserved hypothetical protein [Clo... 102 9e-22 ref|NP_102754.1| (NC_002678) hypothetical protein [Mesorhizobium... 101 2e-21 ref|NP_354696.1| (NC_003062) AGR_C_3139p [Agrobacterium tumefaci... 101 2e-21 ref|NP_385632.1| (NC_003047) CONSERVED HYPOTHETICAL PROTEIN [Sin... 101 2e-21 ref|NP_661042.1| (NC_002932) conserved hypothetical protein [Chl... 100 3e-21 ref|NP_722042.1| (NC_004350) conserved hypothetical protein [Str... 100 4e-21 gb|ZP_00064299.1| (NZ_AAAO01000066) hypothetical protein [Leucon... 100 4e-21 gb|ZP_00004407.1| (NZ_AAAE01000050) hypothetical protein [Rhodob... 100 4e-21 ref|NP_688586.1| (NC_004116) conserved hypothetical protein [Str... 100 4e-21 emb|CAD47303.1| (AL766852) unknown [Streptococcus agalactiae] 100 5e-21 ref|NP_606660.1| (NC_003485) conserved hypothetical protein [Str... 98 2e-20 ref|NP_664071.1| (NC_004070) conserved hypothetical protein [Str... 98 3e-20 ref|NP_268690.1| (NC_002737) conserved hypothetical protein [Str... 98 3e-20 ref|NP_697893.1| (NC_004310) conserved hypothetical protein [Bru... 97 6e-20 emb|CAC19444.1| (AJ277490) hypothetical protein [Streptococcus m... 97 6e-20 gb|ZP_00117780.1| (NZ_AABE01000041) hypothetical protein [Cytoph... 97 6e-20 gb|ZP_00070137.1| (NZ_AAAZ01000010) hypothetical protein [Oenoco... 96 8e-20 ref|NP_346308.1| (NC_003028) conserved hypothetical protein [Str... 96 9e-20 ref|NP_359283.1| (NC_003098) Conserved hypothetical protein [Str... 96 1e-19 ref|NP_267433.1| (NC_002662) HYPOTHETICAL PROTEIN [Lactococcus l... 96 1e-19 ref|NP_219128.1| (NC_000919) conserved hypothetical protein [Tre... 95 2e-19 gb|ZP_00057587.1| (NZ_AAAQ01000029) hypothetical protein [Thermo... 93 7e-19 ref|NP_301976.1| (NC_002677) conserved hypothetical protein [Myc... 93 1e-18 ref|NP_228303.1| (NC_000853) conserved hypothetical protein [The... 93 1e-18 ref|NP_420812.1| (NC_002696) conserved hypothetical protein [Cau... 92 1e-18 ref|NP_600640.2| (NC_003450) hypothetical protein [Corynebacteri... 91 4e-18 gb|ZP_00054139.1| (NZ_AAAP01003810) hypothetical protein [Magnet... 90 9e-18 gb|ZP_00017702.1| (NZ_AAAH01000167) hypothetical protein [Chloro... 88 3e-17 ref|NP_626041.1| (NC_003888) conserved hypothetical protein [Str... 88 3e-17 ref|NP_216225.1| (NC_000962) hypothetical protein Rv1709 [Mycoba... 86 7e-17 gb|ZP_00094099.1| (NZ_AAAV01000112) hypothetical protein [Novosp... 85 2e-16 ref|NP_325946.1| (NC_002771) conserved hypothetical protein [Myc... 82 1e-15 ref|NP_603605.1| (NC_003454) Hypothetical cytosolic protein [Fus... 82 1e-15 gb|ZP_00016048.1| (NZ_AAAG01000012) hypothetical protein [Rhodos... 79 1e-14 ref|NP_619196.1| (NC_003552) conserved hypothetical protein [Met... 77 4e-14 gb|ZP_00078476.1| (NZ_AAAR01001933) hypothetical protein [Methan... 76 7e-14 ref|NP_711435.1| (NC_004342) conserved hypothetical protein [Lep... 76 7e-14 ref|NP_696536.1| (NC_004307) narrowly conserved hypothetical pro... 76 9e-14 ref|NP_633054.1| (NC_003901) conserved protein [Methanosarcina m... 76 1e-13 gb|ZP_00120635.1| (NZ_AABF01000003) hypothetical protein [Bifido... 76 1e-13 ref|NP_078179.1| (NC_002162) conserved hypothetical [Ureaplasma ... 75 2e-13 ref|NP_126049.1| (NC_000868) hypothetical protein [Pyrococcus ab... 75 2e-13 ref|NP_143634.1| (NC_000961) hypothetical protein [Pyrococcus ho... 71 2e-12 ref|NP_109988.1| (NC_000912) bidomainal:Dihydrofolate Reductase ... 71 4e-12 ref|NP_279432.1| (NC_002607) Vng0340c [Halobacterium sp. NRC-1] ... 67 5e-11 ref|NP_213299.1| (NC_000918) hypothetical protein [Aquifex aeoli... 66 1e-10 ref|NP_682448.1| (NC_004113) ORF_ID:tll1658~hypothetical protein... 64 4e-10 ref|NP_579571.1| (NC_003413) hypothetical protein [Pyrococcus fu... 61 5e-09 ref|NP_070388.1| (NC_000917) conserved hypothetical protein [Arc... 60 6e-09 ref|NP_248126.1| (NC_000909) conserved hypothetical protein [Met... 59 1e-08 Sequences not found previously or not previously below threshold: CONVERGED! >ref|NP_242426.1| (NC_002570) BH1560~unknown conserved protein [Bacillus halodurans] dbj|BAB05279.1| (AP001512) BH1560~unknown conserved protein [Bacillus halodurans] Length = 260 Score = 116 bits (293), Expect = 5e-26 Identities = 61/78 (78%), Positives = 70/78 (89%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 M Y VK+DTFEGPLDLLLHLIN+ E+DIYDIPVA ITEQY+ Y+HTM+ L+LD+ASEYL Sbjct: 1 MNPYSVKLDTFEGPLDLLLHLINQAEVDIYDIPVALITEQYMAYIHTMQELQLDVASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLL IKS+MLLPKQ Sbjct: 61 VMAATLLQIKSKMLLPKQ 78 >gb|ZP_00081131.1| (NZ_AAAS01000008) hypothetical protein [Geobacter metallireducens] Length = 324 Score = 116 bits (293), Expect = 5e-26 Identities = 45/73 (61%), Positives = 60/73 (81%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 Y VK++ FEGPLDLLLHLI + E+DIYDIP++ IT++YL Y+ M+ L L+IA E+LVMA Sbjct: 76 YTVKLEVFEGPLDLLLHLIRKNEVDIYDIPLSTITKEYLEYIKMMKELNLEIAGEFLVMA 135 Query: 64 ATLLSIKSRMLLP 76 +TL+ IKS+ LLP Sbjct: 136 STLIQIKSKTLLP 148 >ref|NP_390203.1| (NC_000964) similar to hypothetical proteins [Bacillus subtilis] sp|P35154|YPUG_BACSU Hypothetical protein ypuG (ORFX7) pir||S45549 conserved hypothetical protein ypuG - Bacillus subtilis gb|AAA67487.1| (L09228) ORFX7 [Bacillus subtilis] emb|CAB14254.1| (Z99116) similar to hypothetical proteins [Bacillus subtilis] Length = 251 Score = 114 bits (287), Expect = 2e-25 Identities = 78/78 (100%), Positives = 78/78 (100%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL Sbjct: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLLSIKSRMLLPKQ Sbjct: 61 VMAATLLSIKSRMLLPKQ 78 >gb|ZP_00041528.1| (NZ_AAAM01000048) hypothetical protein [Xylella fastidiosa Ann-1] Length = 338 Score = 113 bits (284), Expect = 5e-25 Identities = 44/76 (57%), Positives = 59/76 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R ++I DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 81 DALEVILDAFEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYINVMQELRFELAAEYLV 140 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 141 MAAILAEIKSRMLLPR 156 >gb|ZP_00038779.1| (NZ_AAAL01000087) hypothetical protein [Xylella fastidiosa Dixon] Length = 338 Score = 113 bits (284), Expect = 5e-25 Identities = 44/76 (57%), Positives = 59/76 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R ++I DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 81 DALEVILDAFEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYINVMQELRFELAAEYLV 140 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 141 MAAILAEIKSRMLLPR 156 >ref|NP_299730.1| (NC_002488) conserved hypothetical protein [Xylella fastidiosa 9a5c] pir||G82554 conserved hypothetical protein XF2451 [imported] - Xylella fastidiosa (strain 9a5c) gb|AAF85250.1|AE004054_2 (AE004054) conserved hypothetical protein [Xylella fastidiosa 9a5c] Length = 338 Score = 113 bits (283), Expect = 7e-25 Identities = 44/76 (57%), Positives = 59/76 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R ++I DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 81 DALEVILDAFEGPLDLLLYLIRRQNLNILDIPVAEITRQYVDYINVMQELRFELAAEYLV 140 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 141 MAAILAEIKSRMLLPR 156 >gb|ZP_00127918.1| (NZ_AABH01000012) hypothetical protein [Pseudomonas syringae pv. syringae B728a] Length = 272 Score = 111 bits (280), Expect = 1e-24 Identities = 45/76 (59%), Positives = 60/76 (78%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++ FEGPLDLLL+LI + IDI DIPVA+IT+QY+ YV M+ + L++A+EYLV Sbjct: 39 DALEVFLEAFEGPLDLLLYLIRKQNIDILDIPVAEITKQYMGYVELMKTVRLELAAEYLV 98 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 99 MAAMLAEIKSRMLLPR 114 >gb|ZP_00022656.1| (NZ_AAAI01000227) hypothetical protein [Ralstonia metallidurans] Length = 343 Score = 111 bits (280), Expect = 2e-24 Identities = 39/75 (52%), Positives = 57/75 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++ FEGPLDLLL+LI + ++ DIP+A++T QYL Y+ +R L++A+EYL+ Sbjct: 104 DALEVFLEAFEGPLDLLLYLIRKQNFNVLDIPMAQVTRQYLSYIEQIRKRNLELAAEYLL 163 Query: 62 MAATLLSIKSRMLLP 76 MAA L+ IKSRMLLP Sbjct: 164 MAAMLIEIKSRMLLP 178 >ref|NP_692749.1| (NC_004193) hypothetical conserved protein [Oceanobacillus iheyensis] dbj|BAC13784.1| (AP004599) hypothetical conserved protein [Oceanobacillus iheyensis] Length = 249 Score = 111 bits (278), Expect = 3e-24 Identities = 61/77 (79%), Positives = 73/77 (94%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E Y+VK+DTFEGPLDLLLHLIN+ EIDIYDIPVA+IT+QY+ Y+HTM+ LEL+IASEYLV Sbjct: 3 EGYKVKLDTFEGPLDLLLHLINQFEIDIYDIPVAQITQQYMEYIHTMQHLELNIASEYLV 62 Query: 62 MAATLLSIKSRMLLPKQ 78 MA+TLL+IKS+MLLPKQ Sbjct: 63 MASTLLAIKSQMLLPKQ 79 >gb|ZP_00083736.1| (NZ_AABA01000085) hypothetical protein [Pseudomonas fluorescens] Length = 272 Score = 109 bits (275), Expect = 6e-24 Identities = 44/76 (57%), Positives = 59/76 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++ FEGPLDLLL+LI + I+I DIPVA+IT QY+ YV M+ + L++A+EYLV Sbjct: 39 DALEVFLEAFEGPLDLLLYLIRKQNINILDIPVAEITRQYMGYVELMQSVRLELAAEYLV 98 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 99 MAAMLAEIKSRMLLPR 114 >ref|NP_637568.1| (NC_003902) conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gb|AAM41492.1| (AE012329) conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] Length = 279 Score = 108 bits (271), Expect = 2e-23 Identities = 45/76 (59%), Positives = 59/76 (77%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R +DI DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 23 DALEVILDAFEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYINVMQELRFELAAEYLV 82 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 83 MAAILAEIKSRMLLPR 98 >ref|NP_471399.1| (NC_003212) similar to unknown proteins [Listeria innocua] emb|CAC97295.1| (AL596170) similar to unknown proteins [Listeria innocua] Length = 249 Score = 108 bits (271), Expect = 2e-23 Identities = 56/78 (71%), Positives = 70/78 (88%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 M E K++ FEGPLDLLLHLI +LE+DIYDIP+A+IT+QY+ +VHTM+ +ELD+ASEYL Sbjct: 1 MVEMNFKVEAFEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHTMQEMELDVASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLL+IKS+MLLPKQ Sbjct: 61 VMAATLLAIKSKMLLPKQ 78 >ref|NP_658098.1| (NC_003995) DUF173, Uncharacterized ACR, COG1354 [Bacillus anthracis A2012] [Bacillus anthracis str. A2012] Length = 247 Score = 108 bits (271), Expect = 2e-23 Identities = 58/75 (77%), Positives = 68/75 (90%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 +Y K++ FEGPLDLLLHLI+R EIDIY+IPVA+ITEQYL YVHTM+ L+LD+ASEYLVM Sbjct: 2 QYNFKVEAFEGPLDLLLHLIHRYEIDIYNIPVAEITEQYLSYVHTMKELQLDVASEYLVM 61 Query: 63 AATLLSIKSRMLLPK 77 AATLL IKS+MLLPK Sbjct: 62 AATLLQIKSKMLLPK 76 >gb|ZP_00029113.1| (NZ_AAAC01000197) hypothetical protein [Burkholderia fungorum] Length = 291 Score = 108 bits (271), Expect = 2e-23 Identities = 42/75 (56%), Positives = 57/75 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++TFEGPLDLLL+LI + ++ DIP+A +T QYL YV +R L++ASEYL+ Sbjct: 56 DALEVFLETFEGPLDLLLYLIRKQNFNVLDIPMADVTVQYLGYVDQLRQTNLELASEYLL 115 Query: 62 MAATLLSIKSRMLLP 76 MAA L+ IKSRMLLP Sbjct: 116 MAAMLIEIKSRMLLP 130 >ref|NP_520507.1| (NC_003295) CONSERVED HYPOTHETICAL PROTEIN [Ralstonia solanacearum] emb|CAD16093.1| (AL646069) CONSERVED HYPOTHETICAL PROTEIN [Ralstonia solanacearum] Length = 293 Score = 108 bits (270), Expect = 2e-23 Identities = 39/75 (52%), Positives = 57/75 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + ++ ++ FEGPLDLLL+LI R ++ DIP+A++T QYL Y+ +R L++A+EYL+ Sbjct: 54 DALEIFLEAFEGPLDLLLYLIRRQNFNVLDIPMAQVTRQYLAYIEQIRATNLELAAEYLL 113 Query: 62 MAATLLSIKSRMLLP 76 MAA L+ IKSRMLLP Sbjct: 114 MAAMLIEIKSRMLLP 128 >ref|NP_642633.1| (NC_003919) conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] gb|AAM37169.1| (AE011869) conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] Length = 279 Score = 108 bits (270), Expect = 2e-23 Identities = 45/76 (59%), Positives = 59/76 (77%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +D FEGPLDLLL+LI R +DI DIPVA+IT QY+ Y++ M+ L ++A+EYLV Sbjct: 23 DALEVILDAFEGPLDLLLYLIRRQNLDILDIPVAEITRQYVDYINVMQELRFELAAEYLV 82 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 83 MAAILAEIKSRMLLPR 98 >gb|ZP_00012384.1| (NZ_AAAF01000001) hypothetical protein [Rhodopseudomonas palustris] Length = 342 Score = 107 bits (269), Expect = 3e-23 Identities = 32/76 (42%), Positives = 54/76 (70%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E + ++ +EGPLDLLL L + ++D++ I + + +QYLL++ R + L++A++YLV Sbjct: 87 EALVIDVEGYEGPLDLLLTLARQQKVDLHKISILALADQYLLFIEEARKIRLELAADYLV 146 Query: 62 MAATLLSIKSRMLLPK 77 MAA L +KSR+LLP+ Sbjct: 147 MAAWLAFLKSRLLLPE 162 >gb|ZP_00089844.1| (NZ_AAAD01000076) hypothetical protein [Azotobacter vinelandii] Length = 268 Score = 107 bits (269), Expect = 3e-23 Identities = 44/76 (57%), Positives = 57/76 (74%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V ++ FEGPLDLLL+LI + IDI DIPVA+IT QY+ YV M+ L++A+EYLV Sbjct: 28 DALEVFLEAFEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYVELMKAARLELAAEYLV 87 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKS MLLP+ Sbjct: 88 MAAMLAEIKSHMLLPR 103 >gb|ZP_00067869.1| (NZ_AAAT01000027) hypothetical protein [Microbulbifer degradans 2-40] Length = 301 Score = 107 bits (268), Expect = 4e-23 Identities = 40/76 (52%), Positives = 55/76 (71%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V +++F GPLDLLL+LI + IDI +I V+ IT QY+ YV M + ++A+EYLV Sbjct: 64 DALEVILESFAGPLDLLLYLIRKQNIDILEIDVSAITHQYVAYVEMMEAVHFELAAEYLV 123 Query: 62 MAATLLSIKSRMLLPK 77 MAA L IKSRMLLP+ Sbjct: 124 MAAMLAEIKSRMLLPR 139 >ref|NP_465475.1| (NC_003210) similar to unknown proteins [Listeria monocytogenes EGD-e] emb|CAD00029.1| (AL591981) similar to unknown proteins [Listeria monocytogenes] Length = 249 Score = 107 bits (268), Expect = 5e-23 Identities = 57/78 (73%), Positives = 70/78 (89%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 M E K+D FEGPLDLLLHLI +LE+DIYDIP+A+IT+QY+ +VHTM+ +ELD+ASEYL Sbjct: 1 MVEMNFKVDAFEGPLDLLLHLIGQLEVDIYDIPMAEITDQYMEFVHTMQEMELDVASEYL 60 Query: 61 VMAATLLSIKSRMLLPKQ 78 VMAATLL+IKS+MLLPKQ Sbjct: 61 VMAATLLAIKSKMLLPKQ 78 >ref|NP_622944.1| (NC_003869) conserved hypothetical protein [Thermoanaerobacter tengcongensis] gb|AAM24548.1| (AE013093) conserved hypothetical protein [Thermoanaerobacter tengcongensis] Length = 247 Score = 107 bits (268), Expect = 5e-23 Identities = 43/75 (57%), Positives = 61/75 (81%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 Y VK++ FEGP DLL HLI + EID+ DIP++ I +QY+ Y+ +++ ++LD+ASE++VM Sbjct: 1 MYTVKLEIFEGPFDLLFHLIEKNEIDLMDIPISIILDQYMEYIRSLQEMDLDVASEFIVM 60 Query: 63 AATLLSIKSRMLLPK 77 AATL+ IKSRMLLPK Sbjct: 61 AATLVEIKSRMLLPK 75 >gb|ZP_00046510.1| (NZ_AAAB01000007) hypothetical protein [Lactobacillus gasseri] Length = 247 Score = 106 bits (267), Expect = 5e-23 Identities = 45/76 (59%), Positives = 55/76 (72%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 +E + + F GPLDLLLHLI +IDIYDIP+AKIT QYL + + L+L IA EY V Sbjct: 5 DELTLDLPNFTGPLDLLLHLIRSQKIDIYDIPIAKITGQYLANLARWQTLDLQIAGEYFV 64 Query: 62 MAATLLSIKSRMLLPK 77 MA+TLL IKS+ LLPK Sbjct: 65 MASTLLRIKSQYLLPK 80 >ref|NP_284420.1| (NC_003116) hypothetical protein [Neisseria meningitidis Z2491] pir||D81866 hypothetical protein NMA1705 [imported] - Neisseria meningitidis (group A strain Z2491) emb|CAB84933.1| (AL162756) hypothetical protein [Neisseria meningitidis Z2491] Length = 284 Score = 106 bits (267), Expect = 6e-23 Identities = 40/76 (52%), Positives = 58/76 (75%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V + +F+GPLDLLL+LI + ID+ DIP+ KITEQYL Y+ + + D+A+EYL+ Sbjct: 35 DALKVVLSSFQGPLDLLLYLIRKQNIDVLDIPMVKITEQYLHYIAQIETYQFDLAAEYLL 94 Query: 62 MAATLLSIKSRMLLPK 77 MAA L+ IKSR+LLP+ Sbjct: 95 MAAMLIEIKSRLLLPR 110 >gb|ZP_00003382.1| (NZ_AAAY01000001) hypothetical protein [Nitrosomonas europaea] Length = 254 Score = 106 bits (267), Expect = 6e-23 Identities = 43/76 (56%), Positives = 60/76 (78%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E Q+ ++TFEGPLDLLL+LI + +DI DIP+A++T QY+ YV TMR + ++A+EYL+ Sbjct: 18 EALQIFLETFEGPLDLLLYLIRKHNLDILDIPMAELTRQYIAYVETMRADQFELAAEYLL 77 Query: 62 MAATLLSIKSRMLLPK 77 M A L+ IKSRMLLP+ Sbjct: 78 MTALLIDIKSRMLLPR 93 >gb|ZP_00061108.1| (NZ_AAAJ01000033) hypothetical protein [Clostridium thermocellum ATCC 27405] Length = 261 Score = 106 bits (266), Expect = 6e-23 Identities = 44/75 (58%), Positives = 60/75 (79%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +KI FEGP DLL HLI + +I+IYDIP+ +IT+QY+ Y+ M+ L+L+IASE+LV Sbjct: 4 KACTIKIQNFEGPFDLLFHLIEKNQINIYDIPIHEITDQYMDYLFAMQELDLEIASEFLV 63 Query: 62 MAATLLSIKSRMLLP 76 MAATLL IKS++LLP Sbjct: 64 MAATLLHIKSKLLLP 78 >ref|NP_372019.1| (NC_002758) conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] ref|NP_374609.1| (NC_002745) conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] ref|NP_646266.1| (NC_003923) conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] dbj|BAB42588.1| (AP003134) conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] dbj|BAB57657.1| (AP003362) conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu50] dbj|BAB95314.1| (AP004827) conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] Length = 251 Score = 106 bits (266), Expect = 7e-23 Identities = 50/75 (66%), Positives = 63/75 (83%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 Y+VK+D F GPLDLLLHLI + EIDIYDIP+ +TEQY+ YVH M+ LE++IASEYLV+ Sbjct: 9 MYEVKLDAFNGPLDLLLHLIQKFEIDIYDIPMQALTEQYMQYVHAMKQLEINIASEYLVL 68 Query: 63 AATLLSIKSRMLLPK 77 A+ LL IKS+MLLP+ Sbjct: 69 ASELLMIKSKMLLPQ 83 >ref|NP_274512.1| (NC_003112) conserved hypothetical protein [Neisseria meningitidis MC58] pir||D81075 conserved hypothetical protein NMB1504 [imported] - Neisseria meningitidis (group B strain MD58) gb|AAF41860.1| (AE002500) conserved hypothetical protein [Neisseria meningitidis MC58] Length = 284 Score = 105 bits (264), Expect = 1e-22 Identities = 40/76 (52%), Positives = 58/76 (75%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 + +V + +F+GPLDLLL+LI + ID+ DIP+ KITEQYL Y+ + + D+A+EYL+ Sbjct: 35 DALKVVLGSFQGPLDLLLYLIRKQNIDVLDIPMVKITEQYLHYIAQIETYQFDLAAEYLL 94 Query: 62 MAATLLSIKSRMLLPK 77 MAA L+ IKSR+LLP+ Sbjct: 95 MAAMLIEIKSRLLLPR 110 >ref|NP_348680.1| (NC_003030) Uncharacterized ptotrin, YPUG B.subtilis ortholog [Clostridium acetobutylicum] gb|AAK80020.1|AE007709_4 (AE007709) Uncharacterized ptotrin, YPUG B.subtilis ortholog [Clostridium acetobutylicum] Length = 249 Score = 104 bits (262), Expect = 2e-22 Identities = 40/74 (54%), Positives = 57/74 (76%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + ID F+GP DLLLHLI + ++DIYDI + IT QY+ Y++ M+ ++L+I SE++VMA Sbjct: 3 LNINIDNFQGPFDLLLHLIRKNKMDIYDIKIFDITNQYIQYLNEMKEMDLEITSEFIVMA 62 Query: 64 ATLLSIKSRMLLPK 77 ATL+ IKS+ LLPK Sbjct: 63 ATLIEIKSKYLLPK 76 >ref|NP_718583.1| (NC_004347) conserved hypothetical protein [Shewanella oneidensis MR-1] gb|AAN56027.1|AE015738_2 (AE015738) Shewanella oneidensis MR-1 complete genome Length = 262 Score = 104 bits (262), Expect = 2e-22 Identities = 39/76 (51%), Positives = 60/76 (78%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E +V +++FEGPLDLLL+LI + ++D+ D+P+++IT QYL Y+ + +++AS+YLV Sbjct: 30 EALEVFLESFEGPLDLLLYLIRKQKLDVVDLPISQITAQYLEYIAMLTQARIELASDYLV 89 Query: 62 MAATLLSIKSRMLLPK 77 MAATL IKSR+LLP+ Sbjct: 90 MAATLAEIKSRLLLPR 105 >ref|NP_251888.1| (NC_002516) conserved hypothetical protein [Pseudomonas aeruginosa PA01] pir||A83244 conserved hypothetical protein PA3198 [imported] - Pseudomonas aeruginosa (strain PAO1) gb|AAG06586.1|AE004744_1 (AE004744) conserved hypothetical protein [Pseudomonas aeruginosa PA01] Length = 250 Score = 103 bits (259), Expect = 4e-22 Identities = 45/74 (60%), Positives = 58/74 (77%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 +V ++ FEGPLDLLL+LI + IDI DIPVA+IT QY+ YV M+ + L++A+EYLVMA Sbjct: 1 MEVFLEAFEGPLDLLLYLIRKQNIDILDIPVAEITRQYMGYVELMKAVRLELAAEYLVMA 60 Query: 64 ATLLSIKSRMLLPK 77 A L IKSRMLLP+ Sbjct: 61 AMLAEIKSRMLLPR 74 >ref|NP_540003.1| (NC_003317) Hypothetical Cytosolic Protein [Brucella melitensis] gb|AAL52267.1| (AE009548) Hypothetical Cytosolic Protein [Brucella melitensis] Length = 283 Score = 103 bits (259), Expect = 5e-22 Identities = 36/75 (48%), Positives = 50/75 (66%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + + FEGPLDLLLHL +D+ I V + EQYL +V R L L++A++YLVMA Sbjct: 35 LLIDVQGFEGPLDLLLHLARNQRVDLARISVLALAEQYLGFVEQARALRLELAADYLVMA 94 Query: 64 ATLLSIKSRMLLPKQ 78 A L +KS++L+PKQ Sbjct: 95 AWLAYLKSKLLIPKQ 109 >ref|NP_562721.1| (NC_003366) conserved hypothetical protein [Clostridium perfringens] dbj|BAB81511.1| (AP003191) conserved hypothetical protein [Clostridium perfringens str. 13] Length = 248 Score = 102 bits (256), Expect = 9e-22 Identities = 41/77 (53%), Positives = 58/77 (75%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 ME +K+ F+GP DLLLHLI + E+ I +I + +IT+QYL Y+ M+ L+L+I SE++ Sbjct: 1 MEMPIIKLKNFDGPFDLLLHLIKKNEMSITEIKIHEITKQYLEYIALMKELDLEITSEFI 60 Query: 61 VMAATLLSIKSRMLLPK 77 VMAATL+ IKS+ LLPK Sbjct: 61 VMAATLIEIKSKSLLPK 77 >ref|NP_102754.1| (NC_002678) hypothetical protein [Mesorhizobium loti] dbj|BAB48540.1| (AP002996) hypothetical protein [Mesorhizobium loti] Length = 285 Score = 101 bits (254), Expect = 2e-21 Identities = 37/75 (49%), Positives = 52/75 (69%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 V + FEGPLDLLLHL ++D+ I + + EQYL +V T R L L++A++YLVMA Sbjct: 37 LVVDVAGFEGPLDLLLHLARTQKVDLARISILALVEQYLAFVETARALRLELAADYLVMA 96 Query: 64 ATLLSIKSRMLLPKQ 78 A L +KS++L+PKQ Sbjct: 97 AWLAFLKSKLLIPKQ 111 >ref|NP_354696.1| (NC_003062) AGR_C_3139p [Agrobacterium tumefaciens] [Agrobacterium tumefaciens str. C58 (Cereon)] ref|NP_532392.1| (NC_003304) conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] gb|AAK87481.1| (AE008092) AGR_C_3139p [Agrobacterium tumefaciens str. C58 (Cereon)] gb|AAL42708.1| (AE009127) conserved hypothetical protein [Agrobacterium tumefaciens str. C58 (U. Washington)] Length = 281 Score = 101 bits (254), Expect = 2e-21 Identities = 33/76 (43%), Positives = 52/76 (68%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 + + FEGPLDLLLHL ++D+ I V + EQYL +V + R + +++A++YLVM Sbjct: 29 GLVIDVAGFEGPLDLLLHLARTQKVDLSRISVLALAEQYLQFVESARRVRIELAADYLVM 88 Query: 63 AATLLSIKSRMLLPKQ 78 AA L +KS++L+P+Q Sbjct: 89 AAWLAFLKSKLLIPQQ 104 >ref|NP_385632.1| (NC_003047) CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] emb|CAC46105.1| (AL591787) CONSERVED HYPOTHETICAL PROTEIN [Sinorhizobium meliloti] Length = 288 Score = 101 bits (253), Expect = 2e-21 Identities = 35/76 (46%), Positives = 51/76 (67%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 +E V I FEGPLDLLLHL +D+ I V + EQY+ +V R + +++A++YLV Sbjct: 33 DELVVDIAGFEGPLDLLLHLARSQRVDLSRISVLALAEQYIAFVERARSIRIELAADYLV 92 Query: 62 MAATLLSIKSRMLLPK 77 MAA L +KSR+L+P+ Sbjct: 93 MAAWLAYLKSRLLIPQ 108 >ref|NP_661042.1| (NC_002932) conserved hypothetical protein [Chlorobium tepidum TLS] gb|AAM71384.1| (AE012792) conserved hypothetical protein [Chlorobium tepidum TLS] Length = 242 Score = 100 bits (251), Expect = 3e-21 Identities = 39/75 (52%), Positives = 60/75 (80%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 +++ ++ FEGPLDLLL I R E+DIY+IP++KIT ++ Y+H MR L L++A+E++ M Sbjct: 1 MFRISLEEFEGPLDLLLFFIKRDELDIYNIPISKITGDFIAYIHAMRRLNLEVAAEFIYM 60 Query: 63 AATLLSIKSRMLLPK 77 A+ L+SIK+RMLLP+ Sbjct: 61 ASMLMSIKARMLLPR 75 >ref|NP_722042.1| (NC_004350) conserved hypothetical protein [Streptococcus mutans UA159] gb|AAN59348.1|AE015000_6 (AE015000) conserved hypothetical protein [Streptococcus mutans UA159] Length = 235 Score = 100 bits (251), Expect = 4e-21 Identities = 41/72 (56%), Positives = 59/72 (81%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ E+DIYD+P+ I EQYL Y+ T++ ++L++A EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYEVDIYDVPIVDIIEQYLAYIATLQAMKLEVAGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >gb|ZP_00064299.1| (NZ_AAAO01000066) hypothetical protein [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] Length = 258 Score = 100 bits (251), Expect = 4e-21 Identities = 41/77 (53%), Positives = 59/77 (76%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 +K+ FEGP+DLLLHLI + E++I+D+ +A IT QYL ++H + ++LD+ASEYLV Sbjct: 9 NGLTIKLSDFEGPIDLLLHLIKKSEMNIFDLKIADITSQYLDFIHAQQAMQLDVASEYLV 68 Query: 62 MAATLLSIKSRMLLPKQ 78 MAATL+ IKS LLP++ Sbjct: 69 MAATLVKIKSADLLPEE 85 >gb|ZP_00004407.1| (NZ_AAAE01000050) hypothetical protein [Rhodobacter sphaeroides] Length = 264 Score = 100 bits (250), Expect = 4e-21 Identities = 37/75 (49%), Positives = 54/75 (71%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E V ++ FEGPLDLLL L ++D+ I V K++EQYLL+V+ + L +++A++YLV Sbjct: 22 EALIVDVEGFEGPLDLLLTLSRTQKVDLRRISVLKLSEQYLLFVNHAKQLRIELAADYLV 81 Query: 62 MAATLLSIKSRMLLP 76 MAA L +KSR+LLP Sbjct: 82 MAAWLAYLKSRLLLP 96 >ref|NP_688586.1| (NC_004116) conserved hypothetical protein [Streptococcus agalactiae 2603V/R] gb|AAN00459.1|AE014264_14 (AE014264) conserved hypothetical protein [Streptococcus agalactiae 2603V/R] Length = 235 Score = 100 bits (250), Expect = 4e-21 Identities = 39/72 (54%), Positives = 59/72 (81%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ E+DIYD+P+ ++ EQYL Y+ T++ + L++A EY++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYEVDIYDVPIVEVIEQYLAYIATLQAMRLEVAGEYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRNLLPK 74 >emb|CAD47303.1| (AL766852) unknown [Streptococcus agalactiae] Length = 235 Score = 100 bits (250), Expect = 5e-21 Identities = 39/72 (54%), Positives = 59/72 (81%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ E+DIYD+P+ ++ EQYL Y+ T++ + L++A EY++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYEVDIYDVPIVEVIEQYLAYIATLQAMRLEVAGEYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRNLLPK 74 >ref|NP_606660.1| (NC_003485) conserved hypothetical protein [Streptococcus pyogenes MGAS8232] gb|AAL97159.1| (AE009983) conserved hypothetical protein [Streptococcus pyogenes MGAS8232] Length = 234 Score = 98.4 bits (245), Expect = 2e-20 Identities = 37/72 (51%), Positives = 61/72 (84%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIY++P+ ++ EQYL Y+ T++V++L++A +Y++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETLQVMKLEVAGDYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRRLLPK 74 >ref|NP_664071.1| (NC_004070) conserved hypothetical protein [Streptococcus pyogenes MGAS315] gb|AAM78874.1| (AE014141) conserved hypothetical protein [Streptococcus pyogenes MGAS315] Length = 234 Score = 98.0 bits (244), Expect = 3e-20 Identities = 37/72 (51%), Positives = 61/72 (84%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIY++P+ ++ EQYL Y+ T++V++L++A +Y++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETLQVMKLEVAGDYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRRLLPK 74 >ref|NP_268690.1| (NC_002737) conserved hypothetical protein [Streptococcus pyogenes] [Streptococcus pyogenes M1 GAS] gb|AAK33411.1| (AE006500) conserved hypothetical protein [Streptococcus pyogenes M1 GAS] Length = 233 Score = 97.6 bits (243), Expect = 3e-20 Identities = 37/72 (51%), Positives = 61/72 (84%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIY++P+ ++ EQYL Y+ T++V++L++A +Y++MA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSQYKVDIYEVPIVEVIEQYLNYIETLQVMKLEVAGDYMLMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRRLLPK 74 >ref|NP_697893.1| (NC_004310) conserved hypothetical protein [Brucella suis 1330] gb|AAN29808.1|AE014391_3 (AE014391) conserved hypothetical protein [Brucella suis 1330] Length = 245 Score = 96.9 bits (241), Expect = 6e-20 Identities = 36/69 (52%), Positives = 48/69 (69%) Query: 10 TFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSI 69 FEGPLDLLLHL +D+ I V + EQYL +V R L L++A++YLVMAA L + Sbjct: 3 GFEGPLDLLLHLARNQRVDLARISVLALAEQYLGFVEQARALRLELAADYLVMAAWLAYL 62 Query: 70 KSRMLLPKQ 78 KS++L+PKQ Sbjct: 63 KSKLLIPKQ 71 >emb|CAC19444.1| (AJ277490) hypothetical protein [Streptococcus mitis] Length = 242 Score = 96.9 bits (241), Expect = 6e-20 Identities = 39/72 (54%), Positives = 58/72 (80%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIYD+P+ ++ EQYL YV T++ + L++ EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYKMDIYDVPITEVIEQYLAYVSTLQAMRLEVTGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >gb|ZP_00117780.1| (NZ_AABE01000041) hypothetical protein [Cytophaga hutchinsonii] Length = 262 Score = 96.9 bits (241), Expect = 6e-20 Identities = 36/74 (48%), Positives = 57/74 (76%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 +++++ F GP DLLL I R E+DIYDIP++KIT +L Y+H + + +DIASE++++A Sbjct: 7 FEIQLPLFAGPFDLLLFFIERDELDIYDIPISKITNDFLEYIHRLEKMNVDIASEFILVA 66 Query: 64 ATLLSIKSRMLLPK 77 ATL+ IK++ LLP+ Sbjct: 67 ATLMRIKAKTLLPR 80 >gb|ZP_00070137.1| (NZ_AAAZ01000010) hypothetical protein [Oenococcus oeni MCW] Length = 247 Score = 96.1 bits (239), Expect = 8e-20 Identities = 39/75 (52%), Positives = 54/75 (72%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 ++ + +D F GPLDLLLHLI E+DI+D+P+AK+T+Q+L ++ LD A EYL Sbjct: 4 KQLTISLDDFSGPLDLLLHLIRTQELDIFDLPIAKVTDQFLSFIDNQLNPSLDSAGEYLY 63 Query: 62 MAATLLSIKSRMLLP 76 MA+TL+ IKSR LLP Sbjct: 64 MASTLIRIKSRFLLP 78 >ref|NP_346308.1| (NC_003028) conserved hypothetical protein [Streptococcus pneumoniae TIGR4] gb|AAK75948.1| (AE007478) conserved hypothetical protein [Streptococcus pneumoniae TIGR4] Length = 242 Score = 96.1 bits (239), Expect = 9e-20 Identities = 39/72 (54%), Positives = 58/72 (80%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIYD+P+ ++ EQYL YV T++ + L++ EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVSTLQAMRLEVTGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >ref|NP_359283.1| (NC_003098) Conserved hypothetical protein [Streptococcus pneumoniae R6] emb|CAC19449.1| (AJ277766) hypothetical protein [Streptococcus pneumoniae] gb|AAL00494.1| (AE008534) Conserved hypothetical protein [Streptococcus pneumoniae R6] Length = 242 Score = 96.1 bits (239), Expect = 1e-19 Identities = 39/72 (54%), Positives = 58/72 (80%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAAT 65 +K+ FEGPLDLLLHL+++ ++DIYD+P+ ++ EQYL YV T++ + L++ EY+VMA+ Sbjct: 3 IKLKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVSTLQAMRLEVTGEYMVMASQ 62 Query: 66 LLSIKSRMLLPK 77 L+ IKSR LLPK Sbjct: 63 LMLIKSRKLLPK 74 >ref|NP_267433.1| (NC_002662) HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis] gb|AAK05375.1|AE006360_4 (AE006360) HYPOTHETICAL PROTEIN [Lactococcus lactis subsp. lactis] Length = 242 Score = 95.7 bits (238), Expect = 1e-19 Identities = 41/76 (53%), Positives = 62/76 (80%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 ++E +KI FEGPLDLLLHL+++ E+DI+++P+ + EQYL+Y+ TM+ LEL++A EY+ Sbjct: 2 IKEINIKIKNFEGPLDLLLHLVSQYEMDIFEVPLVPVIEQYLIYIQTMKELELEVAGEYM 61 Query: 61 VMAATLLSIKSRMLLP 76 +MA+ L+ IKSR LLP Sbjct: 62 LMASQLMLIKSRRLLP 77 >ref|NP_219128.1| (NC_000919) conserved hypothetical protein [Treponema pallidum] pir||H71292 conserved hypothetical protein TP0691 - syphilis spirochete gb|AAC65659.1| (AE001243) conserved hypothetical protein [Treponema pallidum] Length = 252 Score = 95.3 bits (237), Expect = 2e-19 Identities = 39/74 (52%), Positives = 49/74 (65%) Query: 5 QVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAA 64 + K+ FEGPLDLLL LI + E+ IYDIP+ +IT QYL YV +L +E+ MAA Sbjct: 12 EFKLSQFEGPLDLLLFLIKKNELSIYDIPICEITAQYLQYVDQTVSPDLRGLTEFYAMAA 71 Query: 65 TLLSIKSRMLLPKQ 78 LL IKS MLLP + Sbjct: 72 VLLYIKSCMLLPME 85 >gb|ZP_00057587.1| (NZ_AAAQ01000029) hypothetical protein [Thermobifida fusca] Length = 274 Score = 93.0 bits (231), Expect = 7e-19 Identities = 29/76 (38%), Positives = 54/76 (70%), Gaps = 1/76 (1%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMR-VLELDIASEYLV 61 + V +D FEGP DLLL LI++ ++DI ++ ++K+T++++ ++ +LD+ S +L+ Sbjct: 10 GFLVHLDNFEGPFDLLLTLISKHKLDITEVALSKVTDEFIAHIKAYEDSWDLDMVSNFLL 69 Query: 62 MAATLLSIKSRMLLPK 77 +AATLL +K+ LLP+ Sbjct: 70 VAATLLDLKAARLLPR 85 >ref|NP_301976.1| (NC_002677) conserved hypothetical protein [Mycobacterium leprae] pir||S72957 hypothetical protein - Mycobacterium leprae gb|AAA50910.1| (U00021) unknown [Mycobacterium leprae] emb|CAB08281.1| (Z95117) hypothetical protein MLC1351.05c [Mycobacterium leprae] emb|CAC31749.1| (AL583921) conserved hypothetical protein [Mycobacterium leprae] Length = 268 Score = 92.6 bits (230), Expect = 1e-18 Identities = 28/76 (36%), Positives = 50/76 (64%), Gaps = 1/76 (1%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMR-VLELDIASEYL 60 +QV++ FEGP DLLLHLI +D+ ++ + ++T+ ++ Y+ + L L+ + +L Sbjct: 9 NGFQVRLTNFEGPFDLLLHLICAHRLDVTEVALHQVTDDFIAYIRRLGPQLGLEETTAFL 68 Query: 61 VMAATLLSIKSRMLLP 76 V+AATL+ +K+ LLP Sbjct: 69 VIAATLIDLKAARLLP 84 >ref|NP_228303.1| (NC_000853) conserved hypothetical protein [Thermotoga maritima] pir||D72370 conserved hypothetical protein - Thermotoga maritima (strain MSB8) gb|AAD35578.1|AE001726_12 (AE001726) conserved hypothetical protein [Thermotoga maritima] Length = 229 Score = 92.6 bits (230), Expect = 1e-18 Identities = 30/74 (40%), Positives = 57/74 (76%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 K+ FEGPLDLLL+L+ + ++DI +IP++++ ++++ Y+ M+ L++ I S++L MA Sbjct: 3 LVFKLPVFEGPLDLLLYLVRKKKVDIREIPISQLADEFVEYLEHMKKLDMKITSDFLEMA 62 Query: 64 ATLLSIKSRMLLPK 77 +TL+ +KS+ML+P+ Sbjct: 63 STLMELKSKMLIPR 76 >ref|NP_420812.1| (NC_002696) conserved hypothetical protein [Caulobacter crescentus CB15] gb|AAK23980.1| (AE005874) conserved hypothetical protein [Caulobacter crescentus CB15] Length = 274 Score = 92.2 bits (229), Expect = 1e-18 Identities = 31/75 (41%), Positives = 48/75 (63%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 + ID +EGPL +LL L ++D+ + + ++ EQYL +V R + +A++YLVM Sbjct: 23 ALVIDIDGYEGPLHVLLALARSQKVDLLQLSITRLAEQYLAFVQQARRVRFALAADYLVM 82 Query: 63 AATLLSIKSRMLLPK 77 AA L +KSR+LLPK Sbjct: 83 AAWLAYLKSRLLLPK 97 >ref|NP_600640.2| (NC_003450) hypothetical protein [Corynebacterium glutamicum ATCC 13032] dbj|BAB98815.1| (AP005278) Uncharacterized ACR [Corynebacterium glutamicum ATCC 13032] Length = 255 Score = 90.7 bits (225), Expect = 4e-18 Identities = 29/73 (39%), Positives = 53/73 (71%), Gaps = 1/73 (1%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVL-ELDIASEYLVMAA 64 +++D FEGP DLLL LI + ++D+ ++ +A++T++++ Y + +LD +E+LV+AA Sbjct: 1 MQLDNFEGPFDLLLQLITKKKLDVTEVALAQVTDEFIAYTRKLGETSDLDETTEFLVVAA 60 Query: 65 TLLSIKSRMLLPK 77 TLL +K+ LLP+ Sbjct: 61 TLLDLKTARLLPR 73 >gb|ZP_00054139.1| (NZ_AAAP01003810) hypothetical protein [Magnetospirillum magnetotacticum] Length = 272 Score = 89.5 bits (222), Expect = 9e-18 Identities = 30/71 (42%), Positives = 47/71 (65%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 E + +D +EGPLD+LL L ++D+ I + K+ +QYL +V + ++D+A+EYLV Sbjct: 22 ERLLLDLDGWEGPLDVLLQLARDQKVDLAKISILKLADQYLDFVRKVGREQIDLAAEYLV 81 Query: 62 MAATLLSIKSR 72 MAA L +KSR Sbjct: 82 MAAWLAYLKSR 92 >gb|ZP_00017702.1| (NZ_AAAH01000167) hypothetical protein [Chloroflexus aurantiacus] Length = 248 Score = 88.0 bits (218), Expect = 3e-17 Identities = 36/74 (48%), Positives = 49/74 (65%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 Y V + F GPLDLLL LI R E+DI I +A + +QYL +V T+ +E +E++ MA Sbjct: 3 YAVTLPEFTGPLDLLLRLIERAELDITTIALASVADQYLAHVRTLEEVEPRELAEFVSMA 62 Query: 64 ATLLSIKSRMLLPK 77 A L+ IKSR LLP+ Sbjct: 63 ARLILIKSRALLPR 76 >ref|NP_626041.1| (NC_003888) conserved hypothetical protein [Streptomyces coelicolor A3(2)] pir||T36873 hypothetical protein SCI51.10c - Streptomyces coelicolor emb|CAB52834.1| (AL939110) conserved hypothetical protein [Streptomyces coelicolor A3(2)] Length = 264 Score = 88.0 bits (218), Expect = 3e-17 Identities = 28/72 (38%), Positives = 53/72 (72%), Gaps = 1/72 (1%) Query: 6 VKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMR-VLELDIASEYLVMAA 64 +++ FEGP DLLL LI++ ++D+ ++ ++K+T++++ ++ M +LD +E+LV+AA Sbjct: 1 MRLANFEGPFDLLLQLISKHKLDVTEVALSKVTDEFMAHIRAMGPDWDLDQTTEFLVVAA 60 Query: 65 TLLSIKSRMLLP 76 TLL +K+ LLP Sbjct: 61 TLLDLKAARLLP 72 >ref|NP_216225.1| (NC_000962) hypothetical protein Rv1709 [Mycobacterium tuberculosis H37Rv] ref|NP_336206.1| (NC_002755) conserved hypothetical protein [Mycobacterium tuberculosis CDC1551] pir||D70504 hypothetical protein Rv1709 - Mycobacterium tuberculosis (strain H37RV) emb|CAB10966.1| (Z98268) hypothetical protein Rv1709 [Mycobacterium tuberculosis H37Rv] gb|AAK46020.1| (AE007037) conserved hypothetical protein [Mycobacterium tuberculosis CDC1551] Length = 278 Score = 86.5 bits (214), Expect = 7e-17 Identities = 28/75 (37%), Positives = 50/75 (66%), Gaps = 1/75 (1%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMR-VLELDIASEYLV 61 ++V++ FEGP DLLL LI ++D+ ++ + ++T+ ++ Y + LEL+ + +LV Sbjct: 22 GFRVRLTNFEGPFDLLLQLIFAHQLDVTEVALHQVTDDFIAYTKAIGARLELEETTAFLV 81 Query: 62 MAATLLSIKSRMLLP 76 +AATLL +K+ LLP Sbjct: 82 IAATLLDLKAARLLP 96 >gb|ZP_00094099.1| (NZ_AAAV01000112) hypothetical protein [Novosphingobium aromaticivorans] Length = 265 Score = 85.3 bits (211), Expect = 2e-16 Identities = 32/75 (42%), Positives = 52/75 (68%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVM 62 +++D +EGPLDLLL L R ++D+ I + ++ +QYL Y+ L+L++A++YLVM Sbjct: 28 ALYLELDGWEGPLDLLLELARRQKVDLRKISILELVDQYLGYIEQAEALKLELAADYLVM 87 Query: 63 AATLLSIKSRMLLPK 77 AA L +KS +LLP+ Sbjct: 88 AAWLAYLKSLLLLPR 102 >ref|NP_325946.1| (NC_002771) conserved hypothetical protein [Mycoplasma pulmonis] emb|CAC13288.1| (AL445563) conserved hypothetical protein [Mycoplasma pulmonis] Length = 249 Score = 82.2 bits (203), Expect = 1e-15 Identities = 33/74 (44%), Positives = 47/74 (62%) Query: 2 EEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLV 61 I F GPLDLLL L+ IDI++I + ++ QYL + ++ ++D+AS+YLV Sbjct: 8 NGPVFNIKNFSGPLDLLLSLVKDKNIDIFEINLVELATQYLEIIKKLQDDKIDLASDYLV 67 Query: 62 MAATLLSIKSRMLL 75 MAATLL IK+ M L Sbjct: 68 MAATLLQIKASMAL 81 >ref|NP_603605.1| (NC_003454) Hypothetical cytosolic protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gb|AAL94904.1| (AE010581) Hypothetical cytosolic protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] Length = 225 Score = 82.2 bits (203), Expect = 1e-15 Identities = 28/75 (37%), Positives = 52/75 (69%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 MEE VK++ FEGP DLLL+LI + ++ I DI ++++ ++YL + + ++I S+++ Sbjct: 1 MEEVVVKLNNFEGPFDLLLNLIEKNKMKISDINISQLIDEYLEVLRVSKRENIEIKSDFI 60 Query: 61 VMAATLLSIKSRMLL 75 ++A+ L+ IK+ LL Sbjct: 61 IIASELIEIKTLNLL 75 >gb|ZP_00016048.1| (NZ_AAAG01000012) hypothetical protein [Rhodospirillum rubrum] Length = 236 Score = 79.1 bits (195), Expect = 1e-14 Identities = 24/60 (40%), Positives = 40/60 (66%) Query: 17 LLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRMLLP 76 +LL L ++D+ + + ++ EQYL +V R + L++A +YLVMAA L +KSR+L+P Sbjct: 1 MLLTLARSQKVDLTKLSILRLAEQYLAFVARARQIHLELAGDYLVMAAWLAYLKSRLLIP 60 >ref|NP_619196.1| (NC_003552) conserved hypothetical protein [Methanosarcina acetivorans str. C2A] [Methanosarcina acetivorans C2A] gb|AAM07676.1| (AE011151) conserved hypothetical protein [Methanosarcina acetivorans str. C2A] [Methanosarcina acetivorans C2A] Length = 361 Score = 77.2 bits (190), Expect = 4e-14 Identities = 23/72 (31%), Positives = 43/72 (58%), Gaps = 2/72 (2%) Query: 6 VKIDTFEG--PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + + F PL +L+ L +ID +DI V ++T+ +L V ++ ++L I+S L+ + Sbjct: 53 LDLSEFNTYEPLGILVELAKDGKIDPWDIDVVQLTDSFLQRVEELQKMDLRISSRTLLYS 112 Query: 64 ATLLSIKSRMLL 75 A LL +KS ++L Sbjct: 113 AILLRMKSSVIL 124 >gb|ZP_00078476.1| (NZ_AAAR01001933) hypothetical protein [Methanosarcina barkeri] Length = 339 Score = 76.4 bits (188), Expect = 7e-14 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Query: 6 VKIDTFEG--PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + I FE PL +L+ L +ID +DI + ++T+ +L V ++ ++L I+S L+ + Sbjct: 54 LDISEFETSEPLGILVELARVGKIDPWDIDIVQLTDGFLRKVEELKQMDLRISSRTLLYS 113 Query: 64 ATLLSIKSRMLL 75 A LL +KS +L Sbjct: 114 AILLRMKSSGIL 125 >ref|NP_711435.1| (NC_004342) conserved hypothetical protein [Leptospira interrogans serovar lai str. 56601] gb|AAN48453.1|AE011307_6 (AE011307) conserved hypothetical protein [Leptospira interrogans serovar lai str. 56601] Length = 261 Score = 76.4 bits (188), Expect = 7e-14 Identities = 26/65 (40%), Positives = 45/65 (69%) Query: 12 EGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKS 71 EGPL +L LI ++DI+D+ +++IT +L ++ L L++++EY +MAA L+ +KS Sbjct: 23 EGPLSVLWSLIESYKVDIFDVSLSRITRDFLSFLRISETLSLELSAEYALMAANLIYLKS 82 Query: 72 RMLLP 76 + LLP Sbjct: 83 KALLP 87 >ref|NP_696536.1| (NC_004307) narrowly conserved hypothetical protein [Bifidobacterium longum NCC2705] gb|AAN25172.1|AE014767_3 (AE014767) narrowly conserved hypothetical protein [Bifidobacterium longum NCC2705] Length = 304 Score = 76.1 bits (187), Expect = 9e-14 Identities = 24/75 (32%), Positives = 46/75 (61%), Gaps = 1/75 (1%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVL-ELDIASEYLV 61 +QV ++ + GP D LL +I ++++ ++ ++ ITE++L YV + +D AS +L Sbjct: 39 GFQVNLEVYSGPFDALLGMIANNKLELTEVSLSSITEEFLTYVRGLDFTKNMDEASAFLD 98 Query: 62 MAATLLSIKSRMLLP 76 +A+ L+ KS +LP Sbjct: 99 IASILVEAKSVAILP 113 >ref|NP_633054.1| (NC_003901) conserved protein [Methanosarcina mazei Goe1] gb|AAM30726.1| (AE013329) conserved protein [Methanosarcina mazei Goe1] Length = 334 Score = 76.1 bits (187), Expect = 1e-13 Identities = 21/72 (29%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Query: 6 VKIDTFEG--PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMA 63 + + F PL +L+ L +ID +DI V ++T+ +L + ++ ++L I+S L+ + Sbjct: 52 LDLSEFNTCEPLGILVELAKDGKIDPWDIDVVQLTDNFLRRIEELQKMDLRISSRTLLYS 111 Query: 64 ATLLSIKSRMLL 75 A LL +KS +++ Sbjct: 112 AILLRMKSSVIM 123 >gb|ZP_00120635.1| (NZ_AABF01000003) hypothetical protein [Bifidobacterium longum DJO10A] Length = 304 Score = 75.7 bits (186), Expect = 1e-13 Identities = 23/75 (30%), Positives = 46/75 (60%), Gaps = 1/75 (1%) Query: 3 EYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVL-ELDIASEYLV 61 ++V ++ + GP D LL +I ++++ ++ ++ ITE++L YV + +D AS +L Sbjct: 39 GFRVNLEVYSGPFDALLGMIANNKLELTEVSLSSITEEFLTYVRGLDFTKNMDEASAFLD 98 Query: 62 MAATLLSIKSRMLLP 76 +A+ L+ KS +LP Sbjct: 99 IASILVEAKSVAILP 113 >ref|NP_078179.1| (NC_002162) conserved hypothetical [Ureaplasma urealyticum] pir||F82903 conserved hypothetical UU345 [imported] - Ureaplasma urealyticum gb|AAF30754.1|AE002131_8 (AE002131) conserved hypothetical [Ureaplasma urealyticum] Length = 294 Score = 75.3 bits (185), Expect = 2e-13 Identities = 26/74 (35%), Positives = 51/74 (68%), Gaps = 1/74 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTM-RVLELDIASEYLVM 62 ++ K F GPLD L LI + +DI ++ + ++++QY+ +V+ + + +++DI ++L M Sbjct: 14 FEYKFIDFNGPLDTLCVLIKQKRLDINNLDILELSKQYVNFVNQLIKTIDIDILGDHLAM 73 Query: 63 AATLLSIKSRMLLP 76 A+ LL +K+RML+P Sbjct: 74 ASYLLELKTRMLMP 87 >ref|NP_126049.1| (NC_000868) hypothetical protein [Pyrococcus abyssi] pir||A75150 hypothetical protein PAB2110 - Pyrococcus abyssi (strain Orsay) emb|CAB49280.1| (AJ248284) Hypothetical protein [Pyrococcus abyssi] Length = 218 Score = 74.9 bits (184), Expect = 2e-13 Identities = 22/75 (29%), Positives = 47/75 (62%), Gaps = 4/75 (5%) Query: 1 MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYL 60 ME ++ ++ P+D+LL L+ ++D ++I + +TE+Y+ + M+ L+L I++ + Sbjct: 1 MERFEPEVT----PVDILLQLVKMGKVDPWNIDIVDLTEKYIKMLREMQELDLRISARAI 56 Query: 61 VMAATLLSIKSRMLL 75 + A+ L+ +KS LL Sbjct: 57 LAASILVRMKSEALL 71 >ref|NP_143634.1| (NC_000961) hypothetical protein [Pyrococcus horikoshii] pir||E71190 hypothetical protein PH1797 - Pyrococcus horikoshii Length = 213 Score = 71.4 bits (175), Expect = 2e-12 Identities = 20/62 (32%), Positives = 41/62 (65%) Query: 14 PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRM 73 P+D+LL L+ ++D ++I + +TE+Y+ + M+ L+L I++ ++ A+ L+ +KS Sbjct: 8 PVDILLQLVKMGKVDPWNIDIVDLTEKYIKMLREMQELDLRISARAILAASILVRMKSEA 67 Query: 74 LL 75 LL Sbjct: 68 LL 69 >ref|NP_109988.1| (NC_000912) bidomainal:Dihydrofolate Reductase and C-terminal domain is conserved hypo-thetical [Mycoplasma pneumoniae] sp|P75478|Y213_MYCPN Hypothetical protein MG213 homolog (H10_orf506) pir||S73862 dihyrofolate reductase homolog H10_orf506 - Mycoplasma pneumoniae (strain ATCC 29342) gb|AAB96184.1| (AE000052) bidomainal:Dihydrofolate Reductase and C-terminal domain is conserved hypo-thetical [Mycoplasma pneumoniae] Length = 506 Score = 71.1 bits (174), Expect = 4e-12 Identities = 20/73 (27%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Query: 4 YQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHT-MRVLELDIASEYLVM 62 + V ++ + G L LL L+ + +++ + +AKIT QYL ++T + ++ ++YLV+ Sbjct: 161 FNVFLEDYNGTLPNLLELLIDKKFNLHQVDIAKITTQYLHLINTNLNKQAIEPITDYLVI 220 Query: 63 AATLLSIKSRMLL 75 + ++ K+ LL Sbjct: 221 TSRIVEQKANNLL 233 >ref|NP_279432.1| (NC_002607) Vng0340c [Halobacterium sp. NRC-1] gb|AAG18912.1| (AE004993) Vng0340c [Halobacterium sp. NRC-1] Length = 286 Score = 67.2 bits (164), Expect = 5e-11 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 3/62 (4%) Query: 14 PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRM 73 P+ +L+ L R EI+ +DI + +T+++L + +L + L A+ LL +KS Sbjct: 27 PVAVLVRLAERGEIEPWDIDIVAVTDKFLA---ALDEADLRTSGRALFYASVLLRMKSEA 83 Query: 74 LL 75 +L Sbjct: 84 ML 85 >ref|NP_213299.1| (NC_000918) hypothetical protein [Aquifex aeolicus] pir||G70338 conserved hypothetical protein aq_423 - Aquifex aeolicus gb|AAC06703.1| (AE000689) hypothetical protein [Aquifex aeolicus] Length = 205 Score = 65.7 bits (160), Expect = 1e-10 Identities = 17/66 (25%), Positives = 36/66 (53%) Query: 12 EGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKS 71 E P L+L LI ++D +++ + ++ Y+ + + VL+L + + ++ A+ LL K Sbjct: 9 EHPFSLVLPLIEEGKLDPWEVDIVELANLYMEELKKLEVLDLRVPARAILAASFLLRKKI 68 Query: 72 RMLLPK 77 + PK Sbjct: 69 ETIFPK 74 >ref|NP_682448.1| (NC_004113) ORF_ID:tll1658~hypothetical protein [Thermosynechococcus elongatus BP-1] dbj|BAC09210.1| (AP005374) ORF_ID:tll1658~hypothetical protein [Thermosynechococcus elongatus BP-1] Length = 254 Score = 64.1 bits (156), Expect = 4e-10 Identities = 18/59 (30%), Positives = 30/59 (50%) Query: 16 DLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRML 74 D+L+ L R EID +DI V + ++ L + L + + + AA L+ +KS L Sbjct: 23 DILIELAERGEIDPWDIQVVDVCDRCLAELARRGEPNLSESGQAFLYAAMLVLLKSDRL 81 >ref|NP_579571.1| (NC_003413) hypothetical protein [Pyrococcus furiosus DSM 3638] gb|AAL81966.1| (AE010280) hypothetical protein [Pyrococcus furiosus DSM 3638] Length = 212 Score = 60.7 bits (147), Expect = 5e-09 Identities = 21/62 (33%), Positives = 41/62 (65%) Query: 14 PLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRM 73 P+D+LL L+ ++D ++I + +TE+Y+ + M+ L+L I++ ++ AA L+ +KS Sbjct: 7 PVDILLQLVKMGKVDPWNIDIVDLTEKYIKMLREMQELDLRISARAILAAAILVRMKSEA 66 Query: 74 LL 75 LL Sbjct: 67 LL 68 >ref|NP_070388.1| (NC_000917) conserved hypothetical protein [Archaeoglobus fulgidus] pir||F69444 conserved hypothetical protein AF1559 - Archaeoglobus fulgidus gb|AAB89689.1| (AE000995) conserved hypothetical protein [Archaeoglobus fulgidus] Length = 224 Score = 60.3 bits (146), Expect = 6e-09 Identities = 15/54 (27%), Positives = 32/54 (58%) Query: 21 LINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRML 74 + R EID ++I V +T+++L + + L+L ++ L+ AA L+ +K+ + Sbjct: 1 MAKRGEIDPWNIDVVDVTDRFLKRIEDAKKLDLRVSGRVLLYAAILVRMKAEAI 54 >ref|NP_248126.1| (NC_000909) conserved hypothetical protein [Methanococcus jannaschii] [Methanocaldococcus jannaschii] pir||E64441 hypothetical protein MJ1134 - Methanococcus jannaschii gb|AAB99136.1| (U67556) conserved hypothetical protein [Methanococcus jannaschii] [Methanocaldococcus jannaschii] Length = 226 Score = 59.1 bits (143), Expect = 1e-08 Identities = 11/53 (20%), Positives = 33/53 (61%) Query: 22 INRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRML 74 I + ++ +D+ +A+I + Y+ + ++ ++ ++++ +++A LL +KS L Sbjct: 19 IEKKNLNPWDVNIAEIADYYIQKIKELKKFDIRLSADVILVAGILLRMKSEAL 71 Database: nr Posted date: Nov 6, 2002 1:25 PM Number of letters in database: 388,937,031 Number of sequences in database: 1,220,597 Lambda K H 0.316 0.200 0.604 Lambda K H 0.267 0.0612 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 369,393,644 Number of Sequences: 1220597 Number of extensions: 20483437 Number of successful extensions: 50011 Number of sequences better than 1.0e-03: 320 Number of HSP's better than 0.0 without gapping: 307 Number of HSP's successfully gapped in prelim test: 13 Number of HSP's that attempted gapping in prelim test: 49659 Number of HSP's gapped (non-prelim): 325 length of query: 78 length of database: 388,937,031 effective HSP length: 54 effective length of query: 24 effective length of database: 323,024,793 effective search space: 7752595032 effective search space used: 7752595032 T: 11 A: 40 X1: 15 ( 6.8 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (20.5 bits) S2: 101 (42.9 bits)